reg12l precursor (P08542) Protein Card

General Information
Name reg12l precursor (named by ConoServer)
Alternative name(s) Rg3.4 precursor
Organism Conus regius
Organism region Eastern Pacific
Organism diet vermivorous
Protein Type Precursor
Notes This precursor was wrongly assigned to be processed into Reg3l by Franco et al 2018 but the mature peptide correspond to Reg12l.

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework III
Pharmacological family

Sequence
RVLFRSGDQPADQPAERMQDISPEQNPLFHPDKR
RCCPMPG
CFAGPFCPCCPP
Sequence evidence nucleic acid level
Sequence region
[35-53]mature peptideReg12l

References
Franco,A., Dovell,S., Möller,C., Grandal,M., Clark,E. and Marí,F. (2018) Structural plasticity of mini-M conotoxins - expression of all mini-M subtypes by Conus regius. FEBS J. 285:887-902

Internal links
Nucleic acids reg12l precursor
Structure

External links
Ncbi AUJ88062

Tools