C4.40 (P08653) Protein Card

General Information
Name C4.40 (named by ConoServer)
Alternative name(s) Ca053
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework IV
Pharmacological family

Sequence
QKELVPSTITTCCGHEPGTMCPKCMCDNTCPPKRRKTRPQ
Sequence evidence nucleic acid level
Average Mass 4471.23
Monoisotopic Mass 4468.03
Isoelectric Point 11.45
Extinction Coefficient [280nm] NA

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools