C073 (P08661) Protein Card

General Information
Name C073 (named by ConoServer)
Alternative name(s) Ca073
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
DDNPGGTDGKLHKCSTSVWMSLGPLVWLIGIYDCYDSQQCR
TELPYSGLVAPEQ
Sequence evidence nucleic acid level
Average Mass 5943.65
Monoisotopic Mass 5939.76
Isoelectric Point 5.62
Extinction Coefficient [280nm] 15595.00

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools