C6.19 (P08663) Protein Card

General Information
Name C6.19 (named by ConoServer)
Alternative name(s) Ca075
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GMWGECSDWLATCISPSQCCSESCDKRCLAW
Sequence evidence nucleic acid level
Average Mass 3450.87
Monoisotopic Mass 3448.32
Isoelectric Point 4.50
Extinction Coefficient [280nm] 16500.00

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools