Conopeptide-C098 (P08673) Protein Card

General Information
Name Conopeptide-C098 (named by ConoServer)
Alternative name(s) Ca098
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
YPQRREGAPADAANLQSFGPAMMPMQEMQGGQMSGLAGQFL
PFNPNLQMGYKRDFDENLEKRKQNSQLDADENKVPFDSEDN
LGNFLNFLQNEKENKVPFANVDSAATDLGQFEPSAENRDDK
FRFFGNGQ
Sequence evidence nucleic acid level
Average Mass 14760.21
Monoisotopic Mass 14750.91
Isoelectric Point 4.89
Extinction Coefficient [280nm] 2980.00

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools