Contulakin-C101 (P08676) Protein Card

General Information
Name Contulakin-C101 (named by ConoServer)
Alternative name(s) Ca101
Organism Conus catus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class contulakin
Gene superfamily
Pharmacological family

Sequence
GLVPHILTPQHTLQSLTSPLRSNNGGSSGVQLCMWKVCPPS
P
Sequence evidence nucleic acid level
Average Mass 4437.14
Monoisotopic Mass 4434.24
Isoelectric Point 11.81
Extinction Coefficient [280nm] 5500.00

References
Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links
Nucleic acids
Structure

External links

Tools