Vu9.1 precursor (P08682) Protein Card

General Information
Name Vu9.1 precursor (named by ConoServer)
Organism Profundiconus cf. vaubani
Organism region Indo-Pacific
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
MDAQTTLRVWGLVVLATAVVLS
APLHDNQVQLPVHSLEKR
E
CPVSGGRRPFFHCMIACMTTSTDYLCRHHYCKDCAKGNQNG
RMKSQVP
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[23-40]pro region
[41-89]mature peptideVu9.1

References
Fassio, G., Modica, M.V., Mary, L., Zaharias, P., Fedosov, A.E., Gorson, J., Kantor, Y.I., Holford, M. and Puillandre, N. (2019) Venom Diversity and Evolution in the Most Divergent Cone Snail Genus Profundiconus Toxins 11:623

Internal links
Nucleic acids
Structure

External links

Tools