Vu9.1 (P08683) Protein Card

General Information
Name Vu9.1 (named by ConoServer)
Organism Profundiconus cf. vaubani
Organism region Indo-Pacific
Protein Type Wild type
Protein precursor Vu9.1 precursor (8682)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
ECPVSGGRRPFFHCMIACMTTSTDYLCRHHYCKDCAKGNQN
GRMKSQVP
Sequence evidence nucleic acid level
Average Mass 5560.38
Monoisotopic Mass 5556.43
Isoelectric Point 11.73
Extinction Coefficient [280nm] 2980.00

References
Fassio, G., Modica, M.V., Mary, L., Zaharias, P., Fedosov, A.E., Gorson, J., Kantor, Y.I., Holford, M. and Puillandre, N. (2019) Venom Diversity and Evolution in the Most Divergent Cone Snail Genus Profundiconus Toxins 11:623

Internal links
Protein Precursor Vu9.1 precursor (8682)
Nucleic acids
Structure

External links

Tools