Ne6.1 (P08685) Protein Card

General Information
Name Ne6.1 (named by ConoServer)
Organism Profundiconus neocaledonicus
Protein Type Wild type
Protein precursor Ne6.1 precursor (8684)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KIPCMNQCVGQARKPAHQCCEICTDTGTWDCS
Sequence evidence nucleic acid level
Average Mass 3522.00
Monoisotopic Mass 3519.44
Isoelectric Point 7.98
Extinction Coefficient [280nm] 5500.00

References
Fassio, G., Modica, M.V., Mary, L., Zaharias, P., Fedosov, A.E., Gorson, J., Kantor, Y.I., Holford, M. and Puillandre, N. (2019) Venom Diversity and Evolution in the Most Divergent Cone Snail Genus Profundiconus Toxins 11:623

Internal links
Protein Precursor Ne6.1 precursor (8684)
Nucleic acids
Structure

External links

Tools