Im28.1 (P08726) Protein Card

General Information
Name Im28.1 (named by ConoServer)
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im28.1 precursor (8725)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XXVIII
Pharmacological family

Sequence
LHCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPVCTC
PPCL
Sequence evidence protein level
Average Mass 4709.44
Monoisotopic Mass 4705.91
Isoelectric Point 4.68
Extinction Coefficient [280nm] 5500.00

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im28.1 precursor (8725)
Nucleic acids
Structure

External links

Tools