PuIA precursor (P00875) Protein Card

General Information
Name PuIA precursor
Organism Conus pulicarius
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor
Notes The name of this conotoxin does not follow the standard nomenclature. Indeed its cystein pattern doe not correspond to framework I.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVMIVAVLFLTAWTFVTA
DSIRALEDLFAKAPDEMEN
SGASPLNE
RDCRPVGQYCGIPYEHNWRCCSQLCAIICVS
Sequence region
[1-22]signal sequence
[50-80]mature peptidePuIA

References
Zhao,D. and Huang,P. (2000) Cloning of novel conotoxin precursor sequences from Conus pulicarius. Progress in Natural Science 10:33-36

Internal links
Nucleic acids Conus pulicarius conotoxin PuIA precursor (puIA) mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9XYZ0
Ncbi Q9XYZ0, AAD33585

Tools