Im20.1 (P08764) Protein Card

General Information
Name Im20.1 (named by ConoServer)
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im20.1 precursor (8763)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XX
Pharmacological family

Sequence
SVPISCVNPSTPNLQGSWQDKKCCSTKLCSPTNCCESSTCS
CVEGSCQCL
Sequence evidence protein level
Average Mass 5237.87
Monoisotopic Mass 5234.11
Isoelectric Point 7.00
Extinction Coefficient [280nm] 5500.00

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im20.1 precursor (8763)
Nucleic acids
Structure

External links

Tools