ConoCAP precursor (P08785) Protein Card

General Information
Name ConoCAP precursor
Organism Conus villepinii
Organism region Western Atlantic and Caribbean
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conoCAP
Gene superfamily
Pharmacological family

Sequence
MVSLGHVLFVILLPVLLPVAADDPDDQMLSQISLPSSSRSE
YDDNDVSKR
VFCNGFTGCG
GRHRDRSRRQERYGKRLIPVLA
KR
PFCNSFGCYN
GKRSLSGAGPALSTPVDPSRNNKARTMAR
MLDAAASARHEQQQQLLQQREQRGLESRDPAASGDLSKR
LF
CNGYGGCRG
GKRTLYSPWLERMNEVADDRSARNALCTRLGW
RE
Sequence region
[51-60]mature peptideConoCAP-b
[85-94]mature peptideConoCAP-a
[163-173]mature peptideConoCAP-c

References
Möller,C., Melaun,C., Castillo,C., Díaz,M.E., Renzelman,C.M., Estrada,O., Kuch,U., Lokey,S. and Marí,F. (2010) Functional hypervariability and gene diversity of cardioactive neuropeptides. J. Biol. Chem. 285:40673-40680

Internal links
Nucleic acids ConoCAPs
Structure

External links

Tools