LvVIIB precursor 1 (P00879) Protein Card

General Information
Name LvVIIB precursor 1
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLFLTASELVTADYTRDKWQYRAASLRDAMRNFRDT
R
CSPGGEACTRHSPCCTGFLCNHIGGMCHH
Sequence region
[43-71]mature peptideLvVIB 1

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Nucleic acids Conus lividus isolate 2 clone 8a four-loop conotoxin LVVIIB mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9UAB3
Ncbi AAD48157

Tools