LvVIA 1 precursor (P00880) Protein Card

General Information
Name LvVIA 1 precursor
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLFLTASELVTADYT
RDKWQYRAASLRDAMRNFRDT
R
TCSPAGEVCTSKSPCCTGFLCSHIGGMCHH
Sequence region
[1-20]signal sequence
[43-72]mature peptideLvVIA 1

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Nucleic acids Conus lividus isolate 2 clone 9a four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 11b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 11b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 2 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 3 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 5 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 7 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 8 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 9 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 13 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 15 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 17 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 20 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 2a four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 3a four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 3b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 5b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 6b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 8b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 9b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 10b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 13b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 14b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 1 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 3 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 4 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 15 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 2a four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 4a four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 11a four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 6b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 7b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 8b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 18b four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 8 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 12 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 2 clone 16 four-loop conotoxin LVVIA mRNA, partial cds
Conus lividus isolate 1 clone 5a four-loop conotoxin LVVIA mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9TVN1
Ncbi AAD48213, AAD48209, AAD48208, AAD48206, AAD48205, AAD48204, AAD48203, AAD48202, AAD48201, AAD48200, AAD48199, AAD48198, AAD48197, AAD48196, AAD48188, AAD48187, AAD48186, AAD48185, AAD48184, AAD48183, AAD48182, AAD48181, AAD48180, AAD48179, AAD48178, AAD48177, AAD48176, AAD48175, AAD48174, AAD48173, AAD48172, AAD48171, AAD48170, AAD48169, AAD48168, AAD48165, AAD48162, AAD48158, Q9TVN1

Tools