Con-ins Im1 B chain (P08835) Protein Card

General Information
Name Con-ins Im1 B chain (named by ConoServer)
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Con-ins Im1 precursor (6942)

Classification
Conopeptide class coninsulin
Gene superfamily Insulin superfamily
Pharmacological family

Sequence
TCTLETRMQGAHPQGICGSKLPDIVHTVCQVMGRGYAGGQR
QLRK
Sequence evidence nucleic acid level
Average Mass 4883.68
Monoisotopic Mass 4880.44
Isoelectric Point 10.53
Extinction Coefficient [280nm] 1865.00

References
Safavi-Hemami,H., Gajewiak,J., Karanth,S., Robinson,S.D., Ueberheide,B., Douglass,A.D., Schlegel,A., Imperial,J.S., Watkins,M., Bandyopadhyay,P.K., Yandell,M., Li,Q., Purcell,A.W., Norton,R.S., Ellgaard,L. and Olivera,B.M. (2015) Specialized insulin is used for chemical warfare by fish-hunting cone snails. Proc. Natl. Acad. Sci. U.S.A. 112:1743-1748

Internal links
Protein Precursor Con-ins Im1 precursor (6942)
Nucleic acids
Structure

External links

Tools