Eb6.23 (P08870) Protein Card

General Information
Name Eb6.23 (named by ConoServer)
Alternative name(s) Eb6.1
Organism Conus ebraeus
Organism region Indo-Pacific,Eastern Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Eb6.23 precursor (6846)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
PKASELDKRSCYEAGEFCFFSVPGLFICCSSVCLFHVCL
Sequence evidence nucleic acid level
Average Mass 4331.04
Monoisotopic Mass 4327.93
Isoelectric Point 6.63
Extinction Coefficient [280nm] 1490.00

References
Jin,A.H., Israel,M.R., Inserra,M.C., Smith,J.J., Lewis,R.J., Alewood,P.F., Vetter,I. and Dutertre,S. (2015) δ-Conotoxin SuVIA suggests an evolutionary link between ancestral predator defence and the origin of fish-hunting behaviour in carnivorous cone snails. Proc. Biol. Sci. 282

Internal links
Protein Precursor Eb6.23 precursor (6846)
Nucleic acids
Structure

External links

Tools