conophysin-conopressin Mi precursor (P08932) Protein Card

General Information
Name conophysin-conopressin Mi precursor (named by ConoServer)
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
MKCSVLQMSRLSWAMCLMLLMV
LLLGTAHGCFIRNCPRGGK
RAVDAVQPTRQCMPCGPDGMGQCVGPSVCCGLGLGCLMGTP
ETEVCQKENESAVPCAISGRHCGMDNTGNCVADGICCVEDA
CSFNSLCRVDTDQEDSVSARQELLTLIRRLLVNRQYD
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Nucleic acids conophysin-conopressin Mi precursor
Structure

External links
Ncbi ATJ04133

Tools