conophysin-conopressin Ar precursor (P08939) Protein Card

General Information
Name conophysin-conopressin Ar precursor (named by ConoServer)
Organism Conus araneosus
Organism region Indo-Pacific
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
MQMGRPTLLPCLLLLLVLSTQA
CFIRNCPKG
GKRNVDEGPT
KPCMFCSFGQCVGPNICCGARGCEMGTTEANRCIEEDEDPI
PCWVFGDHCILNNRGNIHGNCVANGICCGDDTCTTHWGCL
Sequence evidence nucleic acid level
Sequence region
[1-22]signal sequence
[23-31]mature peptideconopressin-G

References
Kumar,S., Vijayasarathy,M., Venkatesha,M.A., Sunita,P. and Balaram,P. (2020) Cone Snail Analogs of the Pituitary Hormones Oxytocin/Vasopressin and Their Carrier Protein Neurophysin. Proteomic and Transcriptomic Identification of Conopressins and Conophysins Biochim Biophys Acta Proteins Proteom 1868:140391

Internal links
Nucleic acids conophysin-conopressin Ar precursor
Structure

External links
Ncbi ATJ04126

Tools