PiXXA (P08998) Protein Card

General Information
Name PiXXA
Organism Conus princeps (Prince cone)
Organism region Eastern Pacific
Protein Type Wild type
Protein precursor PiXXA precursor (8999)

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family alpha conotoxin

Sequence
AVKKTCIRSTOGSNWGRCCLTKMCHTLCCARSDCTCVYRSG
KGHGCSCTS
Modified residues
positionsymbolname
11O4-Hydroxyproline
Sequence evidence protein level
Average Mass 5368.19
Monoisotopic Mass 5364.27
Isoelectric Point 12.56
Extinction Coefficient [280nm] 6990.00

Activity

IC50: Nicotinic acetylcholine receptors

TargetOrganismIC50AgonistRef
α7H. sapiens6.2 uM[4.6-8.2]Ach(100 uM)Hernández-Sámano,A.C. et al. (2019)

Percentage inhibition: Nicotinic acetylcholine receptors

TargetOrganism% inhibitionConcentrationRef
α3β2H. sapiens6.7+/-3.10.07 ug/uLHernández-Sámano,A.C. et al. (2019)
α7H. sapiens55.4+/-15.20.07 ug/uLHernández-Sámano,A.C. et al. (2019)

References
Hernández-Sámano,A.C., Falcón,A., Zamudio,F., Batista,C.V.F., Michel-Morfín,J.E., Landa-Jaime,V., López-Vera,E., Jeziorski,M.C. and Aguilar,M.B. (2019) αD-Conotoxins in Species of the Eastern Pacific: The Case of Conus princeps from Mexico. Toxins (Basel) 11:405

Internal links
Protein Precursor PiXXA precursor (8999)
Nucleic acids
Structure

External links

Tools