thyrostimulin-beta 5 (P09168) Protein Card

General Information
Name thyrostimulin-beta 5
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor thyrostimulin-beta 5 precursor (6869)
Notes The sequence was predicted from the precursor by ConoServer.

Classification
Conopeptide class thyrostimulin
Gene superfamily
Pharmacological family

Sequence
TTLQCHVRSYTFRATKPPIVNENGDPVTCQGDVRVSSCWGR
CDSSEIGDYKMPFKISNHPVCTYTGRVSRTVRLSQCAGYPD
PTVQVFDATGCACQFCNSETQLCEKLN(nh2)
Modified residues
positionsymbolname
110nh2C-term amidation
Average Mass 12066.54
Monoisotopic Mass 12058.55
Isoelectric Point 10.28
Extinction Coefficient [280nm] 11460.00

References
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S. and Safavi-Hemami,H. (2017) Hormone-like peptides in the venoms of marine cone snails. Gen. Comp. Endocrinol. 244:11-18

Internal links
Protein Precursor thyrostimulin-beta 5 precursor (6869)
Nucleic acids
Structure

External links

Tools