thyrostimulin-alpha 2 (P09169) Protein Card

General Information
Name thyrostimulin-alpha 2
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor thyrostimulin-alpha 2 precursor (6868)

Classification
Conopeptide class thyrostimulin
Gene superfamily
Pharmacological family

Sequence
TGQKSILGSPGCHLVGHTRVVRIPDCVPFQITTNACRGFCV
SYAIPSPYQTLVYNPNHIITSRAACCDIIDTLDIPVQVTCV
DGVREIVFKSARSCACSIC
Sequence evidence nucleic acid level
Average Mass 10876.59
Monoisotopic Mass 10869.30
Isoelectric Point 11.07
Extinction Coefficient [280nm] 4470.00

References
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S. and Safavi-Hemami,H. (2017) Hormone-like peptides in the venoms of marine cone snails. Gen. Comp. Endocrinol. 244:11-18

Internal links
Protein Precursor thyrostimulin-alpha 2 precursor (6868)
Nucleic acids
Structure

External links

Tools