LVVICa precursor (P00956) Protein Card

General Information
Name LVVICa precursor
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLSLTACQLTTAETYPRGQQTHHALRSTDKNSKLTR
GCTPRNGFCRYHSDCCSNFCHTWAIMCL
Sequence region
[42-71]mature peptideLVVICa

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Nucleic acids Conus lividus isolate 1 clone 21 four-loop conotoxin LVVIC mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9UA98
Ncbi AAD48234

Tools