ABVII precursor (P00959) Protein Card

General Information
Name ABVII precursor
Organism Conus abbreviatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLFLTACQLTTA
ETSSRGKQNHRALRSTDKNSRMTK
R
CTPAGDACDATTECCILFCNLATKKCQVPTFP
Sequence region
[1-17]signal sequence
[43-74]mature peptideABVII

References
Duda,T.F. Jr. and Palumbi,S.R. (1999) Molecular genetics of ecological diversification: duplication and rapid evolution of toxin genes of the venomous gastropod Conus Proc. Natl. Acad. Sci. U.S.A. 96:6820-6823

Internal links
Nucleic acids Conus abbreviatus isolate 1 clone 13 four-loop conotoxin ABVII mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot Q9UA96
Ncbi AAD48237

Tools