Protein List

Your search: Protein Type in [Synthetic] and PTM in [4-Hydroxyproline]

Found 309 entries.


ID Name Gene superfamily Organism Sequence
P04343 Ac-L1 synthetic construct (Ac)LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P07498 Bru9a-GLP cyclic synthetic construct SCGGSCFGGCWOGCSCYARTCFRDGLP
P05869 BuIA[P6O] synthetic construct GCCSTOPCAVLYC(nh2)
P02854 CMrVIA [K6P] synthetic construct VCCGYPLCHOC
P02855 CMrVIA [K6P] amidated synthetic construct VCCGYPLCHOC(nh2)
P02856 CMrVIA amidated synthetic construct VCCGYKLCHOC(nh2)
P07643 conantokin-G[+10O] synthetic construct GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2)
P05847 Conantokin-Rl2[K8Nle] synthetic construct GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA
N(nh2)
P05844 Conantokin-Rl2[L5Y] synthetic construct GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P08996 Conomarphin Eb1[f13A] synthetic construct GWVYHAHPEONSAWT
P08997 Conomarphin Eb1[f13F] synthetic construct GWVYHAHPEONSFWT
P08923 conomarphin-Ac1 amidated synthetic construct NYYLYOAROENSwwT(nh2)
P08925 conomarphin-Ac1[E10(Gla), W14(Gla)] synthetic construct NYYLYOARO(Gla)NSw(Gla)T
P08926 conomarphin-Ac1[E10(Gla), W14(Gla)] amidated synthetic construct NYYLYOARO(Gla)NSw(Gla)T(nh2)
P08924 conomarphin-Ac1[E10(Gla)] synthetic construct NYYLYOARO(Gla)NSwwT
P08917 conomarphin-Ac1[E10A] synthetic construct NYYLYOAROANSwwT
P08914 conomarphin-Ac1[L4A] synthetic construct NYYAYOAROENSwwT
P08919 conomarphin-Ac1[N11A] synthetic construct NYYLYOAROEASwwT
P08911 conomarphin-Ac1[N1A] synthetic construct AYYLYOAROENSwwT
P08916 conomarphin-Ac1[O6A] synthetic construct NYYLYAAROENSwwT
P08918 conomarphin-Ac1[O9A] synthetic construct NYYLYOARAENSwwT
P08928 conomarphin-Ac1[R8A] synthetic construct NYYLYOAAOENSwwT
P08920 conomarphin-Ac1[S12A] synthetic construct NYYLYOAROENAwwT
P08915 conomarphin-Ac1[T15A] synthetic construct NYYLYOAROENSwwA
P08921 conomarphin-Ac1[W13A] synthetic construct NYYLYOAROENSAwT
P08922 conomarphin-Ac1[W14A] synthetic construct NYYLYOAROENSwAT
P08913 conomarphin-Ac1[Y2A] synthetic construct NAYLYOAROENSwwT
P08912 conomarphin-Ac1[Y3A] synthetic construct NYALYOAROENSwwT
P08927 conomarphin-Ac1[Y5A] synthetic construct NYYLAOAROENSwwT
P01355 Contryphan-R [Des-Gly1] synthetic construct COwQPWC(nh2)
P01262 Cyclic contryphan synthetic construct GCOyNPKC(nh2)
P02848 Cyclic MrIA synthetic construct NGVCCGYKLCHOCAG
P09022 EI[D2A] synthetic construct RAOCCYHPTCNMSNPQIC(nh2)
P09036 EI[del1-2] synthetic construct OCCYHPTCNMSNPQIC(nh2)
P09035 EI[del1] synthetic construct DOCCYHPTCNMSNPQIC(nh2)
P09025 EI[H7A] synthetic construct RDOCCYAPTCNMSNPQIC(nh2)
P09034 EI[I17A] synthetic construct RDOCCYHPTCNMSNPQAC(nh2)
P09029 EI[M12A] synthetic construct RDOCCYHPTCNASNPQIC(nh2)
P09028 EI[N11A] synthetic construct RDOCCYHPTCAMSNPQIC(nh2)
P09031 EI[N14A] synthetic construct RDOCCYHPTCNMSAPQIC(nh2)
P09032 EI[P15A] synthetic construct RDOCCYHPTCNMSNAQIC(nh2)
P09026 EI[P8A] synthetic construct RDOCCYHATCNMSNPQIC(nh2)
P09033 EI[Q16A] synthetic construct RDOCCYHPTCNMSNPAIC(nh2)
P09021 EI[R1A] synthetic construct ADOCCYHPTCNMSNPQIC(nh2)
P09030 EI[S13A] synthetic construct RDOCCYHPTCNMANPQIC(nh2)
P09027 EI[T9A] synthetic construct RDOCCYHPACNMSNPQIC(nh2)
P09024 EI[Y6A] synthetic construct RDOCCAHPTCNMSNPQIC(nh2)
P03561 GID [(Gla)4A] synthetic construct IRDACCSNPACRVNNOHVC
P08779 GID [(Gla)4E, A10Q] synthetic construct IRDECCSNPQCRVNNOHVC
P07544 GID [(Gla)4E, A10S] synthetic construct IRDECCSNPSCRVNNOHVC
P07545 GID [(Gla)4E, A10T] synthetic construct IRDECCSNPTCRVNNOHVC
P07502 GID [(Gla)4E, A10V] synthetic construct IRDECCSNPVCRVNNOHVC
P07553 GID [(Gla)4E, N15H] synthetic construct IRDECCSNPACRVNHOHVC
P07552 GID [(Gla)4E, N15K] synthetic construct IRDECCSNPACRVNKOHVC
P07546 GID [(Gla)4E, V13F] synthetic construct IRDECCSNPACRFNNOHVC
P08780 GID [(Gla)4E, V13I] synthetic construct IRDECCSNPACRINNOHVC
P07549 GID [(Gla)4E, V13I] synthetic construct IRDECCSNPACRINNOHVC
P07548 GID [(Gla)4E, V13L] synthetic construct IRDECCSNPACRLNNOHVC
P07550 GID [(Gla)4E, V13S] synthetic construct IRDECCSNPACRSNNOHVC
P07551 GID [(Gla)4E, V13T] synthetic construct IRDECCSNPACRTNNOHVC
P07547 GID [(Gla)4E, V13W] synthetic construct IRDECCSNPACRWNNOHVC
P07503 GID [(Gla)4E, V13Y] synthetic construct IRDECCSNPACRYNNOHVC
P07556 GID [(Gla)4E, V18N] synthetic construct IRDECCSNPACRVNNOHNC
P07555 GID [(Gla)4E, V18Q] synthetic construct IRDECCSNPACRVNNOHQC
P07554 GID [(Gla)4E, V18Y] synthetic construct IRDECCSNPACRVNNOHYC
P03553 GID [(Gla)4E] synthetic construct IRDECCSNPACRVNNOHVC
P07542 GID [(Gla)4Q] synthetic construct IRDQCCSNPACRVNNOHVC
P03560 GID [D3A,(Gla)4E] synthetic construct IRAECCSNPACRVNNOHVC
P07541 GID [D3N, (Gla)4E] synthetic construct IRNECCSNPACRVNNOHVC
P07543 GID [D3N,E4Q] synthetic construct IRNQCCSNPACRVNNOHVC
P03558 GID [I1A, (Gla)4E] synthetic construct ARDECCSNPACRVNNOHVC
P04481 GID [R12A] synthetic construct IRD(Gla)CCSNPACAVNNOHVC
P03559 GID [R2A, (Gla)4E] synthetic construct IADECCSNPACRVNNOHVC
P07540 GID [R2K, (Gla)4E] synthetic construct IKDECCSNPACRVNNOHVC
P03557 GID amidated [(GLA)4E] synthetic construct IRDECCSNPACRVNNOHVC(nh2)
P03571 GID[(GLA)4E, H17A] synthetic construct IRDECCSNPACRVNNOAVC
P03567 GID[(GLA)4E, N14A] synthetic construct IRDECCSNPACRVANOHVC
P03568 GID[(GLA)4E, N15A] synthetic construct IRDECCSNPACRVNAOHVC
P03563 GID[(GLA)4E, N8A] synthetic construct IRDECCSAPACRVNNOHVC
P03564 GID[(GLA)4E, P9A] synthetic construct IRDECCSNAACRVNNOHVC
P03562 GID[(GLA)4E, S7A] synthetic construct IRDECCANPACRVNNOHVC
P03566 GID[(GLA)4E, V13A] synthetic construct IRDECCSNPACRANNOHVC
P03572 GID[(GLA)4E, V18A] synthetic construct IRDECCSNPACRVNNOHAC
P03573 GID[del1, R2A, (GLA)4E] synthetic construct ADECCSNPACRVNNOHVC
P03574 GID[Del1-2,D3A, (GLA)4E] synthetic construct AECCSNPACRVNNOHVC
P03576 GID[Del1-3, (GLA)4A] synthetic construct ACCSNPACRVNNOHVC
P03575 GID[Del1-3, (GLA)4E] synthetic construct ECCSNPACRVNNOHVC
P03577 GID[Del4] synthetic construct CCSNPACRVNNOHVC
P03565 GID[R12A] synthetic construct IRD(Gla)CCSNPACRVNNOHVC
P07484 GIIIA [A10C, A21C] M superfamily Conus geographus (Geography cone) RDCCTOOKKAKDRQCKOQRCAA(nh2)
P07486 GIIIA [A3C,A10C,A15C,A21C] M superfamily Conus geographus (Geography cone) RDACTOOKKAKDRQAKOQRCAA(nh2)
P07488 GIIIA [A3C,A4C,A10C,A15C,A20C,A21C] M superfamily Conus geographus (Geography cone) RDAATOOKKAKDRQAKOQRAAA(nh2)
P07485 GIIIA [A3C,A4C,A15C,A20C] M superfamily Conus geographus (Geography cone) RDAATOOKKCKDRQAKOQRACA(nh2)
P07482 GIIIA [A3C] M superfamily Conus geographus (Geography cone) RDACTOOKKCKDRQAKOQRCCA(nh2)
P07487 GIIIA [A4C,A10C,A20C,A21C] M superfamily Conus geographus (Geography cone) RDCATOOKKAKDRQCKOQRAAA(nh2)
P07483 GIIIA [A4C,C20A] M superfamily Conus geographus (Geography cone) RDCATOOKKCKDRQCKOQRACA(nh2)
P01570 GIIIA [R13A] synthetic construct RDCCTOOKKCKDAQCKOQRCCA(nh2)
P01780 GVIA [O10>K] synthetic construct CKSOGSSCSKTSYNCCRSCNOYTKRCY(nh2)
P05701 GVIA[C8U,C19U] synthetic construct CKSOGSSUSOTSYNCCRSUNOYTKRCY(nh2)
P06955 GVIIJ covalent dimer synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYTKTCKDKSSA
P08797 GVIIJ[(Btr)2A,(Scc)24(Eac)] synthetic construct GACGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08818 GVIIJ[(Btr)2W,(Scc)24(Eac),D31K] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKKKSSA
P08814 GVIIJ[(Btr)2W,(Scc)24(Eac),K27D] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTDTCKDKSSA
P08816 GVIIJ[(Btr)2W,(Scc)24(Eac),K27F] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTFTCKDKSSA
P08815 GVIIJ[(Btr)2W,(Scc)24(Eac),K27G] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTGTCKDKSSA
P08819 GVIIJ[(Btr)2W,(Scc)24(Eac),K32D] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDDSSA
P08810 GVIIJ[(Btr)2W,(Scc)24(Eac),Y25A] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)ATKTCKDKSSA
P08812 GVIIJ[(Btr)2W,(Scc)24(Eac),Y25D] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)DTKTCKDKSSA
P08811 GVIIJ[(Btr)2W,(Scc)24(Eac),Y25R] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)RTKTCKDKSSA
P06951 GVIIJ[(Btr)2W,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P06954 GVIIJ[(Btr)2W,(Scc)24(Msc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Msc)YTKTCKDKSSA
P06834 GVIIJ[(Btr)2W,(Scc)24(Sgc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Sgc)YTKTCKDKSSA
P06953 GVIIJ[(Btr)2W,(Scc)24(Smc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Smc)YTKTCKDKSSA
P06952 GVIIJ[(Btr)2W,(Scc)24(Tcc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Tcc)YTKTCKDKSSA
P08813 GVIIJ[(Btr)2W,(Scc)24C,T26A] synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYAKTCKDKSSA
P08817 GVIIJ[(Btr)2W,(Scc)24C,T28A] synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYTKACKDKSSA
P06833 GVIIJ[(Btr)2W,(Scc)24C] synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYTKTCKDKSSA
P06956 GVIIJ[(Btr)2W,(Scc)24S] synthetic construct GWCGDOGATCGKLRLYCCSGFCDSYTKTCKDKSSA
P08808 GVIIJ[(Btr)2W,D23(Gla),(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFC(Gla)(Eac)YTKTCKDKS
SA
P08809 GVIIJ[(Btr)2W,D23N,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFCN(Eac)YTKTCKDKSSA
P08798 GVIIJ[(Btr)2W,D5K,(Scc)24(Eac)] synthetic construct GWCGKOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08807 GVIIJ[(Btr)2W,F21A,(Scc)24C] synthetic construct GWCGDOGATCGKLRLYCCSGACDCYTKTCKDKSSA
P08801 GVIIJ[(Btr)2W,K12D,(Scc)24(Eac)] synthetic construct GWCGDOGATCGDLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08802 GVIIJ[(Btr)2W,L13A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKARLYCCSGFCD(Eac)YTKTCKDKSSA
P08804 GVIIJ[(Btr)2W,L15A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRAYCCSGFCD(Eac)YTKTCKDKSSA
P08803 GVIIJ[(Btr)2W,R14D,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLDLYCCSGFCD(Eac)YTKTCKDKSSA
P08806 GVIIJ[(Btr)2W,S19A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCAGFCD(Eac)YTKTCKDKSSA
P08800 GVIIJ[(Btr)2W,T9A,(Scc)24(Eac)] synthetic construct GWCGDOGAACGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08805 GVIIJ[(Btr)2W,Y16A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLACCSGFCD(Eac)YTKTCKDKSSA
P06835 GVIIJ[(Btr)2W] O1 superfamily GWCGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKSSA
P04418 ImI [P60] synthetic construct GCCSDORCAWRC(nh2)
P02857 marmophin [d13>D] synthetic construct DWEYHAHPKONSFWT
P07649 MoVIB[R13Y] synthetic construct CKPOGSKCSOSMYDCCTTCISYTKRCRKYY
P08720 MrIA [del1,Y7Sty] synthetic construct GVCCG(sTy)KLCHOC
P08715 MrIA [del1-2] synthetic construct VCCGYKLCHOC
P08716 MrIA [del1-4] synthetic construct CGYKLCHOC
P08717 MrIA [del1-5] synthetic construct GYKLCHOC
P08718 MrIA [del1-6] synthetic construct YKLCHOC
P07576 MrIA [insN_(Hfe)] synthetic construct (HFE)NGVCCGYKLCHOC(nh2)
P08714 MrIA [insN_LR] synthetic construct LRNGVCCGYKLCHOC
P07575 MrIA [insN_W] synthetic construct WNGVCCGYKLCHOC(nh2)
P07571 MrIA [N1(Abz)] synthetic construct (ABZ)GVCCGYKLCHOC(nh2)
P07560 MrIA [N1(Bhk)] synthetic construct (BHK)GVCCGYKLCHOC(nh2)
P07568 MrIA [N1(Cit)] synthetic construct (Cit)GVCCGYKLCHOC(nh2)
P07574 MrIA [N1(Dmf)] synthetic construct (DMF)GVCCGYKLCHOC(nh2)
P07563 MrIA [N1(Nle)] synthetic construct (Nle)GVCCGYKLCHOC(nh2)
P07565 MrIA [N1A] synthetic construct AGVCCGYKLCHOC(nh2)
P07570 MrIA [N1D] synthetic construct DGVCCGYKLCHOC(nh2)
P07567 MrIA [N1F] synthetic construct FGVCCGYKLCHOC(nh2)
P07564 MrIA [N1G] synthetic construct GGVCCGYKLCHOC(nh2)
P07566 MrIA [N1I] synthetic construct IGVCCGYKLCHOC(nh2)
P07561 MrIA [N1k] synthetic construct kGVCCGYKLCHOC(nh2)
P07572 MrIA [N1n] synthetic construct nGVCCGYKLCHOC(nh2)
P07569 MrIA [N1Q] synthetic construct QGVCCGYKLCHOC(nh2)
P07559 MrIA [N1r] synthetic construct rGVCCGYKLCHOC(nh2)
P07558 MrIA [N1R] synthetic construct RGVCCGYKLCHOC(nh2)
P07562 MrIA [N1S] synthetic construct SGVCCGYKLCHOC(nh2)
P07573 MrIA [N1T] synthetic construct TGVCCGYKLCHOC(nh2)
P07635 MrIA [N1Z, C10c] synthetic construct ZGVCCGYKLcHOC(nh2)
P07637 MrIA [N1Z, C13c] synthetic construct ZGVCCGYKLCHOc(nh2)
P07636 MrIA [N1Z, C4c, C13c] synthetic construct ZGVcCGYKLCHOc(nh2)
P07633 MrIA [N1Z, C4c, C5c, C10c, C13c] synthetic construct ZGVccGYKLcHOc(nh2)
P07638 MrIA [N1Z, C4c] synthetic construct ZGVcCGYKLCHOC(nh2)
P07634 MrIA [N1Z, C5c, C10c] synthetic construct ZGVCcGYKLcHOC(nh2)
P07640 MrIA [N1Z, Y7(Mty), H11W] synthetic construct ZGVCCG(Mty)KLCWOC(nh2)
P07641 MrIA [N1Z, Y7(Mty), L9(Cha), H11W] synthetic construct ZGVCCG(Mty)K(Cha)CWOC(nh2)
P07621 MrIA [N1Z,H11(Bta)] synthetic construct ZGVCCGYKLC(BTA)OC(nh2)
P07616 MrIA [N1Z,H11(Fla)] synthetic construct ZGVCCGYKLC(FLA)OC(nh2)
P07620 MrIA [N1Z,H11(Nal)] synthetic construct ZGVCCGYKLC(Nal)OC(nh2)
P07617 MrIA [N1Z,H11(Pya)] synthetic construct ZGVCCGYKLC(PYA)OC(nh2)
P07625 MrIA [N1Z,H11E] synthetic construct ZGVCCGYKLCEOC(nh2)
P07615 MrIA [N1Z,H11F] synthetic construct ZGVCCGYKLCFOC(nh2)
P07622 MrIA [N1Z,H11h] synthetic construct ZGVCCGYKLChOC(nh2)
P07624 MrIA [N1Z,H11L] synthetic construct ZGVCCGYKLCLOC(nh2)
P07623 MrIA [N1Z,H11P] synthetic construct ZGVCCGYKLCPOC(nh2)
P07626 MrIA [N1Z,H11Q] synthetic construct ZGVCCGYKLCQOC(nh2)
P07614 MrIA [N1Z,H11R] synthetic construct ZGVCCGYKLCROC(nh2)
P07619 MrIA [N1Z,H11W] synthetic construct ZGVCCGYKLCWOC(nh2)
P07618 MrIA [N1Z,H11Y] synthetic construct ZGVCCGYKLCYOC(nh2)
P07603 MrIA [N1Z,K8(Cit)] synthetic construct ZGVCCGY(Cit)LCHOC(nh2)
P07596 MrIA [N1Z,K8(Hly)] synthetic construct ZGVCCGY(HLY)LCHOC(nh2)
P07602 MrIA [N1Z,K8(Nle)] synthetic construct ZGVCCGY(Nle)LCHOC(nh2)
P07595 MrIA [N1Z,K8(Orn)] synthetic construct ZGVCCGY(Orn)LCHOC(nh2)
P07601 MrIA [N1Z,K8E] synthetic construct ZGVCCGYELCHOC(nh2)
P07600 MrIA [N1Z,K8I] synthetic construct ZGVCCGYILCHOC(nh2)
P07594 MrIA [N1Z,K8k] synthetic construct ZGVCCGYkLCHOC(nh2)
P07599 MrIA [N1Z,K8L] synthetic construct ZGVCCGYLLCHOC(nh2)
P07598 MrIA [N1Z,K8Q] synthetic construct ZGVCCGYQLCHOC(nh2)
P07597 MrIA [N1Z,K8R] synthetic construct ZGVCCGYRLCHOC(nh2)
P07604 MrIA [N1Z,K8W] synthetic construct ZGVCCGYWLCHOC(nh2)
P07608 MrIA [N1Z,L9(Cha)] synthetic construct ZGVCCGYK(Chg)CHOC(nh2)
P07607 MrIA [N1Z,L9(Hle)] synthetic construct ZGVCCGYK(HLE)CHOC(nh2)
P07606 MrIA [N1Z,L9(Nle)] synthetic construct ZGVCCGYK(Nle)CHOC(nh2)
P07610 MrIA [N1Z,L9I] synthetic construct ZGVCCGYKICHOC(nh2)
P07611 MrIA [N1Z,L9P] synthetic construct ZGVCCGYKPCHOC(nh2)
P07609 MrIA [N1Z,L9Q] synthetic construct ZGVCCGYKQCHOC(nh2)
P07612 MrIA [N1Z,L9R] synthetic construct ZGVCCGYKRCHOC(nh2)
P07613 MrIA [N1Z,L9S] synthetic construct ZGVCCGYKSCHOC(nh2)
P07605 MrIA [N1Z,L9V] synthetic construct ZGVCCGYKVCHOC(nh2)
P07582 MrIA [N1Z,Y7(Cha)] synthetic construct ZGVCCG(Cha)KLCHOC(nh2)
P07577 MrIA [N1Z,Y7(Dmk)] synthetic construct ZGVCCG(DMF)KLCHOC(nh2)
P07578 MrIA [N1Z,Y7(Dpa)] synthetic construct ZGVCCG(DPA)KLCHOC(nh2)
P07579 MrIA [N1Z,Y7(Hly)] synthetic construct ZGVCCG(HLY)KLCHOC(nh2)
P07581 MrIA [N1Z,Y7(Mty)] synthetic construct ZGVCCG(Mty)KLCHOC(nh2)
P07593 MrIA [N1Z,Y7(Thi)] synthetic construct ZGVCCG(THI)KLCHOC(nh2)
P07584 MrIA [N1Z,Y7E] synthetic construct ZGVCCGEKLCHOC(nh2)
P07580 MrIA [N1Z,Y7F] synthetic construct ZGVCCGFKLCHOC(nh2)
P07585 MrIA [N1Z,Y7I] synthetic construct ZGVCCGIKLCHOC(nh2)
P07586 MrIA [N1Z,Y7K] synthetic construct ZGVCCGKKLCHOC(nh2)
P07587 MrIA [N1Z,Y7L] synthetic construct ZGVCCGLKLCHOC(nh2)
P07588 MrIA [N1Z,Y7P] synthetic construct ZGVCCGPKLCHOC(nh2)
P07589 MrIA [N1Z,Y7Q] synthetic construct ZGVCCGQKLCHOC(nh2)
P07590 MrIA [N1Z,Y7R] synthetic construct ZGVCCGRKLCHOC(nh2)
P07591 MrIA [N1Z,Y7S] synthetic construct ZGVCCGSKLCHOC(nh2)
P07583 MrIA [N1Z,Y7W] synthetic construct ZGVCCGWKLCHOC(nh2)
P07592 MrIA [N1Z,Y7y] synthetic construct ZGVCCGyKLCHOC(nh2)
P06932 MrIA [N1Z] synthetic construct ZGVCCGYKLCHOC(nh2)
P04492 MrIA amidated synthetic construct NGVCCGYKLCHOC(nh2)
P02849 MrIB amidated synthetic construct VGVCCGYKLCHOC(nh2)
P04446 OIVA [H10P] synthetic construct CCGVONAACPOCVCKNTC(nh2)
P04447 OIVA [K15N] synthetic construct CCGVONAACHOCVCNNTC(nh2)
P06789 PeIA[P13O] synthetic construct GCCSHPACSVNHOELC(nh2)
P06784 PeIA[P6O] synthetic construct GCCSHOACSVNHPELC(nh2)
P08506 PIC [O7P] Conus purpurascens SGCCKHOACGKNRC
P04296 PIIIA [G6K] synthetic construct ZRLCCKFOKSCRSRQCKOHRCC(nh2)
P04300 PIIIA [K17A] synthetic construct ZRLCCAFOKSCRSRQCAOHRCC(nh2)
P04301 PIIIA [K17Q] synthetic construct ZRLCCAFOKSCRSRQCQOHRCC(nh2)
P04294 PIIIA [K17R] synthetic construct ZRLCCGFOKSCRSRQCROHRCC(nh2)
P04297 PIIIA [R12A] synthetic construct ZRLCCAFOKSCASRQCKOHRCC(nh2)
P04293 PIIIA [R12K] synthetic construct ZRLCCGFOKSCKSRQCKOHRCC(nh2)
P04298 PIIIA [R12Q] synthetic construct ZRLCCAFOKSCQSRQCKOHRCC(nh2)
P04290 PIIIA [R14A] synthetic construct ZRLCCGFOKSCRSAQCKOHRCC(nh2)
P04292 PIIIA [R14K] synthetic construct ZRLCCGFOKSCRSKQCKOHRCC(nh2)
P04291 PIIIA [R14Q] synthetic construct ZRLCCGFOKSCRSQQCKOHRCC(nh2)
P04302 PIIIA [R20A] synthetic construct ZRLCCAFOKSCRSRQCKOHACC(nh2)
P04295 PIIIA [R2A] synthetic construct ZALCCGFOKSCRSRQCKOHRCC(nh2)
P04299 PIIIA [S13D] synthetic construct ZRLCCAFOKSCRDRQCKOHRCC(nh2)
P04448 PIIIE [K9S] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04449 PIIIE [R12O,Y13F] synthetic construct HOOCCLYGKCROFOGCSSASCCQR(nh2)
P04450 PIIIE [S17Y,S18N,S20L] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04452 PIIIF [O12R,F13Y] synthetic construct GOOCCLYGSCRRYOGCYNALCCRK(nh2)
P04451 PIIIF [S9K] synthetic construct GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04453 PIIIF [Y17S,N18S,L20S] synthetic construct GOOCCLYGSCROFOGCSSASCCRK(nh2)
P01612 PIVA [Hyp7P,Hyp13P] synthetic construct GCCGSYPNAACHPCSCKDROSYCGQ(nh2)
P04431 PnIA [P6O] synthetic construct GCCSLOPCAANNPD(sTy)C(nh2)
P04364 PVIIA [D13A] synthetic construct CRIONQKCFQHLADCCSRKCNRFNKCV(nh2)
P04369 PVIIA [F23A] synthetic construct CRIONQKCFQHLDDCCSRKCNRANKCV(nh2)
P04359 PVIIA [F9A] synthetic construct CRIONQKCAQHLDDCCSRKCNRFNKCV(nh2)
P04360 PVIIA [F9M] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04361 PVIIA [F9Y] synthetic construct CRIONQKCYQHLDDCCSRKCNRFNKCV(nh2)
P04363 PVIIA [H11A] synthetic construct CRIONQKCFQALDDCCSRKCNRFNKCV(nh2)
P04355 PVIIA [I3A] synthetic construct CRAONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P07500 PVIIA [insN_GGG,insC_LPET] cyclic synthetic construct GGGORIPNQKCFQHLDDCCSRKCNRFNKCVLPET
P04367 PVIIA [K19A] synthetic construct CRIONQKCFQHLDDCCSRACNRFNKCV(nh2)
P04371 PVIIA [K25A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNACV(nh2)
P04357 PVIIA [K7A] synthetic construct CRIONQACFQHLDDCCSRKCNRFNKCV(nh2)
P04358 PVIIA [K7R] synthetic construct CRIONQRCFQHLDDCCSRKCNRFNKCV(nh2)
P04370 PVIIA [N24A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFAKCV(nh2)
P04362 PVIIA [Q10A] synthetic construct CRIONQKCFAHLDDCCSRKCNRFNKCV(nh2)
P04356 PVIIA [Q6A] synthetic construct CRIONAKCFQHLDDCCSRKCNRFNKCV(nh2)
P04366 PVIIA [R18A] synthetic construct CRIONQKCFQHLDDCCSAKCNRFNKCV(nh2)
P04368 PVIIA [R22A] synthetic construct CRIONQKCFQHLDDCCSRKCNAFNKCV(nh2)
P04352 PVIIA [R2A] synthetic construct CAIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04354 PVIIA [R2K] synthetic construct CKIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04353 PVIIA [R2Q] synthetic construct CQIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04365 PVIIA [S17A] synthetic construct CRIONQKCFQHLDDCCARKCNRFNKCV(nh2)
P04237 RIIIJΔ10-11 synthetic construct LOOCCTOOKRLCOAOACKYKOCCKS
P04234 RIIIJΔ6-11 synthetic construct LOOCCSLNLRLCOAOACKYKOCCKS
P04235 RIIIJΔ6-8 synthetic construct LOOCCSLNKKHCOAOACKYKOCCKS
P04236 RIIIJΔ9-11 synthetic construct LOOCCTOOLRLCOAOACKYKOCCKS
P04337 RIIIK [K18A] synthetic construct LOSCCSLNLRLCOVOACARNOCCT(nh2)
P04339 RIIIK [K18R, R19K] synthetic construct LOSCCSLNLRLCOVOACRKNOCCT(nh2)
P04333 RIIIK [L11A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04325 RIIIK [L1A] synthetic construct AOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04344 RIIIK [L1E] synthetic construct EOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04350 RIIIK [L1F] synthetic construct FOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04345 RIIIK [L1H] synthetic construct HOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04346 RIIIK [L1I] synthetic construct IOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04348 RIIIK [L1K] synthetic construct KOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04347 RIIIK [L1M] synthetic construct MOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04349 RIIIK [L1R] synthetic construct ROSCCSLNLRLCOVOACKRNOCCT(nh2)
P04351 RIIIK [L1Y] synthetic construct YOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04329 RIIIK [L7A] synthetic construct LOSCCSANLRLCOVOACKRNOCCT(nh2)
P04331 RIIIK [L9A] synthetic construct LOSCCSLNARLCOVOACKRNOCCT(nh2)
P04340 RIIIK [N20A] synthetic construct LOSCCSLNLRLCOVOACKRAOCCT(nh2)
P04330 RIIIK [N8A] synthetic construct LOSCCSLALRLCOVOACKRNOCCT(nh2)
P04334 RIIIK [O13A] synthetic construct LOSCCSLNLRLCAVOACKRNOCCT(nh2)
P04336 RIIIK [O15A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04341 RIIIK [O21A] synthetic construct LOSCCSLNLRLCOVOACKRNACCT(nh2)
P04326 RIIIK [O2A] synthetic construct LASCCSLNLRLCOVOACKRNOCCT(nh2)
P04332 RIIIK [R10A] synthetic construct LOSCCSLNLALCOVOACKRNOCCT(nh2)
P04338 RIIIK [R19A] synthetic construct LOSCCSLNLRLCOVOACKANOCCT(nh2)
P04327 RIIIK [S3A] synthetic construct LOACCSLNLRLCOVOACKRNOCCT(nh2)
P04328 RIIIK [S6A] synthetic construct LOSCCALNLRLCOVOACKRNOCCT(nh2)
P04342 RIIIK [T24A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCA(nh2)
P04335 RIIIK [V14A] synthetic construct LOSCCSLNLRLCOAOACKRNOCCT(nh2)
P04238 RIIIKΔ9 synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P02784 RXIA [BTr33>W] synthetic construct GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS
SFfKI
P03902 Sr1.1 synthetic construct RTCCSROTCRMEYPELCG(nh2)
P04445 SrIB [Gla15E] synthetic construct RTCCSROTCRMEYPELCG(nh2)
P05821 TIIIA[E15A,insC_A] synthetic construct RHGCCKGOKGCSSRACROQHCCA(nh2)
P05822 TIIIA[E15A,insC_AA] synthetic construct RHGCCKGOKGCSSRACROQHCCAA(nh2)
P05826 TIIIA[E15A,insC_AD] synthetic construct RHGCCKGOKGCSSRACROQHCCAD(nh2)
P05825 TIIIA[E15A,insC_AK] synthetic construct RHGCCKGOKGCSSRACROQHCCAK(nh2)
P05824 TIIIA[E15A,insC_D] synthetic construct RHGCCKGOKGCSSRACROQHCCD(nh2)
P05823 TIIIA[E15A,insC_K] synthetic construct RHGCCKGOKGCSSRACROQHCCK(nh2)
P05820 TIIIA[E15A] synthetic construct RHGCCKGOKGCSSRACROQHCC(nh2)
P04466 Vc1.1 [P6O] synthetic construct GCCSDORCNYDHPEIC(nh2)
P09005 Vc1.1[P6(Hyp)] synthetic construct GCCSDORCNYDHPEIC(nh2)