Protein List

Your search: Protein Type in [Wild type] and Sequence evidence in [protein level] and PTM in [4-Hydroxyproline]

Found 110 entries.


ID Name Gene superfamily Organism Sequence
P05524 As25a Conus austini CKCOSCNFNDVTENCKCCIFRQO(nh2)
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(BTr)EPWC(nh2)
P01811 Bromosleeper peptide O3 superfamily Conus radiatus (BTr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW
QCV(Gla)ACPV
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
HP(nh2)
P04136 Cal5a Divergent MRFYIGLMAA Conus californicus DAADVKOVARTNEGOGRDOAOCCQHPIETCC
P02840 CaXVIIA Y superfamily Conus caracteristicus CGGTGDSCNEOAGELCCRRLKCVNSRCCPTTDGC
P01510 CcTx A superfamily Conus consors AOWLVP(gSr)QITTCCGYNOGTMCOSCMCTNTC
P01537 CMrVIA Conus marmoreus VCCGYKLCHOC
P01738 CMrX T superfamily Conus marmoreus GICCGVSFCYOC
P05348 CnID A superfamily Conus consors CCHOACGKHFNC
P05353 CnIK Conus consors NGRCCHOACGKYYSC(nh2)
P01632 CnVIIA O1 superfamily Conus consors CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2)
P02835 conomarphin-Mr1 M superfamily Conus marmoreus DWEYHAHPKONSfWT
P05440 conomarphin-Mr2 M superfamily Conus marmoreus DWVNHAHOQONSIWS
P02481 Conophan-mus-V Conus mus SOANS(hVa)WS
P03726 conopressin-Tx Conus textile (Cloth-of-gold cone) CFIRNCPO
P01268 conotoxin-GS O1 superfamily Conus geographus (Geography cone) ACSGRGSRCOOQCCMGLRCGRGNPQKCIGAH(Gla)DV
P01270 Contryphan-Am Conus amadis GCOwDPWC(nh2)
P01372 Contryphan-R O2 superfamily Conus radiatus GCOwEPWC(nh2)
P03549 Contryphan-S O2 superfamily Conus striatus (Striated cone) GCOwEPWC(nh2)
P01318 Contryphan-Sm O2 superfamily Conus stercusmuscarum GCOwQPWC(nh2)
P02622 Contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) GCOwQPYC(nh2)
P02550 De13a Conus delessertii DCOTSCOTTCANG(BTr)ECC(hLy)GYOCVN(hLy)ACSG
CTH(nh2)
P03629 De7b Conus delessertii DCIOGG(Gla)NCDVFROYRCCSGYCILLLCA
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P02843 Di19A Divergent MSTLGMTLL- Conus distans GCDOTDGCQTTVC(Gla)TDTGOCCCKPNFTCQISNSGTKS
CSCSGQOSDCOV
P00050 EI A superfamily Conus ermineus (Atlantic fish-hunting cone) RDOCCYHPTCNMSNPQIC(nh2)
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P01635 EIVA Conus ermineus (Atlantic fish-hunting cone) GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2)
P01740 EIVB Conus ermineus (Atlantic fish-hunting cone) GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2)
P01561 EVIA O1 superfamily Conus ermineus (Atlantic fish-hunting cone) DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2)
P00098 GID A superfamily Conus geographus (Geography cone) IRD(Gla)CCSNPACRVNNOHVC
P01571 GIIIA M superfamily Conus geographus (Geography cone) RDCCTOOKKCKDRQCKOQRCCA(nh2)
P01566 GIIIB M superfamily Conus geographus (Geography cone) RDCCTOORKCKDRRCKOMKCCA(nh2)
P01744 GIIIC Conus geographus (Geography cone) RDCCTOOKKCKDRRCKOLKCCA(nh2)
P01511 Gla(1)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) GM(BTr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla)
GSCTM(BTr)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02847 Gla(3)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) LCODYT(Gla)OCSHAH(Gla)CCSWNCYNGHCTG
P01546 GVIA O1 superfamily Conus geographus (Geography cone) CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2)
P01743 GVIIA O1 superfamily Conus geographus (Geography cone) CKSOGTOCSRGMRDCCTSCLLYSNKCRRY
P02581 GVIIB Conus geographus (Geography cone) CKSOGTOCSRGMRDCCTSCLSYSNKCRRY
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(BTr)GCG
CACS(nh2)
P02625 LtIIIA M superfamily Conus litteratus D(Gla)CC(Gla)OQWCDGACDCCS
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
COOKRKO(nh2)
P05459 Mr062 O1 superfamily Conus marmoreus CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC
AT(BTr)LDL
P04662 Mr1.8 A superfamily Conus marmoreus ROECCTHOACHVSNPELCS
P05484 Mr10.2 T superfamily Conus marmoreus ACCVYKICYOC
P05367 Mr11.1 I1 superfamily Conus marmoreus DKWGTCSLLGKGCRHHSDCCWDLCCTGKTCVMTVLOCLFLS
LIVRWT
P05487 Mr15.1 N superfamily Conus marmoreus CSSGKTCGSVEOVLCCARSDCYCRLIQTRSYWVOICVCP
P05489 Mr15.2 N superfamily Conus marmoreus CRSGKTCORVGODVCC(Gla)RSDCFCKLVOARPFWRYRCI
CL
P05416 Mr3.11 M superfamily Conus marmoreus CCRIACNLKCNOCC(nh2)
P05380 Mr6.16 O2 superfamily Conus marmoreus TTAES(BTr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL
P05495 Mr6.23 H superfamily Conus marmoreus STDCNGVOCQFGCCVTINGNDECRELDC
P05514 Mr6.24 H superfamily Conus marmoreus STDCNGVOCEFGCCVTINGNDECREIGCE
P05503 Mr6.26 H superfamily Conus marmoreus IEEDCGYVOCEFGCCRIIDGKEKCREIDCQ
P01384 MrIA T superfamily Conus marmoreus NGVCCGYKLCHOC
P01737 MrIB T superfamily Conus marmoreus VGVCCGYKLCHOC
P01422 MrIIIA M superfamily Conus marmoreus GCCGSFACRFGCVOCCV
P01465 MrIIIB M superfamily Conus marmoreus SKQCCHLAACRFGCTOCCW
P01486 MrIIIC M superfamily Conus marmoreus CCAPSACRLGCROCCR
P02696 MrIIID M superfamily Conus marmoreus CCRLSCGLGCHOCC(nh2)
P02698 MrIIIG M superfamily Conus marmoreus DCCOLPACPFGCNOCC(nh2)
P03603 Ms20.4 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCMTRMCGTMCCARSGCTCV
YHWRRGHGCSCPG
P01519 NgVIA Conus nigropunctatus SKCFSOGTFCGIKOGLCCSVRCFSLFCISFE
P01397 OIVA A superfamily Conus obscurus CCGVONAACHOCVCKNTC(nh2)
P01688 OIVB A superfamily Conus obscurus CCGVONAACPOCVCNKTCG(nh2)
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P01611 PIIIE M superfamily Conus purpurascens HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P01594 PIIIF M superfamily Conus purpurascens GOOCCLYGSCROFOGCYNALCCRK(nh2)
P01449 PIVA A superfamily Conus purpurascens GCCGSYONAACHOCSCKDROSYCGQ(nh2)
P01636 PnVIIA O2 superfamily Conus pennaceus DCTSWFGRCTVNS(Gla)CCSNSCDQTYC(Gla)LYAFOS
P02859 PrXA Conus parius TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2)
P02595 PVIA O1 superfamily Conus purpurascens EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2)
P01356 PVIIA O1 superfamily Conus purpurascens CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P01494 Reg12a M superfamily Conus regius GCCOOQWCGODCTSOCC
P01493 Reg12e M superfamily Conus regius KCCMRPICTCOCCIGP(nh2)
P01490 Reg12h M superfamily Conus regius GCCSOWNCIQLRACOCCON
P01488 Reg12k M superfamily Conus regius KCCMRPICMCOCCIGAG
P00028 Reg1b/Reg1c A superfamily Conus regius GCCSDORCKHQC(nh2)
P00030 Reg1e A superfamily Conus regius GCCSDORCRYRC(nh2)
P00031 Reg1f A superfamily Conus regius DYCCRROOCTLIC(nh2)
P00840 RXIA I1 superfamily Conus radiatus GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS
SFfKI
P00842 RXIB I1 superfamily Conus radiatus GOSFCKANGKOCSYHADCCNCCLSGICKOSTNVILPGCSTS
SFfRI
P02592 RXIC I1 superfamily Conus radiatus GOSFCKADEKOCKYHADCCNCCLGGICKOSTSWIGCSTNVF
lT
P00843 RXID I1 superfamily Conus radiatus GCKKDRKOCSYHADCCNCCLSGICAOSTNWILPGCSTSTFT
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02980 Sm1.1 A superfamily Conus stercusmuscarum GRCCHPACGONYSC(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P01794 SVIA O1 superfamily Conus striatus (Striated cone) CRSSGSOCGVTSICCGRCYRGKCT(nh2)
P02710 SVIE O1 superfamily Conus striatus (Striated cone) DGCSSGGTFCGIHOGLCCSEFCFLWCITFID
P01405 TVIIA O1 superfamily Conus tulipa (tulip cone) SCSGRDSRCOOVCCMGLMCSRGKCVSIYGE
P02883 Tx1.2 A superfamily Conus textile (Cloth-of-gold cone) ROQCCSHOACNVDHPEIC
P03755 Tx10b Conus textile (Cloth-of-gold cone) DPCCGYRMCVOC(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P03749 Tx3e Conus textile (Cloth-of-gold cone) SCCNAGFCRFGCTOCCY
P05831 Tx3i Conus textile (Cloth-of-gold cone) CCGOTACLAGCKPCC(nh2)
P05834 Tx3j Conus textile (Cloth-of-gold cone) CCDDSECSTSCWOCCY
P05835 Tx6.5 Conus textile (Cloth-of-gold cone) NCPYCVVYCCPOAYCQASGCRPP
P02881 TxIA A superfamily Conus textile (Cloth-of-gold cone) GCCSROOCIANNPDLC(nh2)
P05832 TxIC T superfamily Conus textile (Cloth-of-gold cone) DKQTCCGYRMCVOC(nh2)
P02562 TxIIIC M superfamily Conus textile (Cloth-of-gold cone) CCRTCFGCTOCC(nh2)
P03212 TxMEKL-P2 O2 superfamily Conus textile (Cloth-of-gold cone) DCRGYDAOCSSGAPCCD(BTr)(BTr)TCSARTNRCF
P03156 TxMMSK-03 M superfamily Conus textile (Cloth-of-gold cone) CCNAGFCRFGCTOCCY
P02556 TxO4 O1 superfamily Conus textile (Cloth-of-gold cone) YDCEPPGNFCGMIKIGPOCCSG(BTr)CFFACA
P01543 TxVA T superfamily Conus textile (Cloth-of-gold cone) (Gla)CC(Gla)DG(BTr)CC(gTr)AAO
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02540 VcVA T superfamily Conus victoriae CCPGKOCCRI(nh2)
P01686 VxXXA D superfamily Conus vexillum DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGR
GHGCSC