Protein List

Your search: PTM in [4-Hydroxyproline]

Found 520 entries.


ID Name Gene superfamily Organism Sequence
P04343 Ac-L1 synthetic construct (Ac)LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P08391 Am1.5 A superfamily Conus amadis ROECCSHOACNVDHOEIC
P08407 Am6.6 O2 superfamily Conus amadis GCTWWFGRCAEDGECCSNSCDQTYCELYAFOS
P04230 Ar1248 Conus araneosus GVCCGVSFCYOC
P04229 Ar1311 Conus araneosus RCCGYKMCHOC
P04232 Ar1446 Conus araneosus CCRLACGLGCHOCC(nh2)
P05524 As25a Conus austini CKCOSCNFNDVTENCKCCIFRQO(nh2)
P01628 AVIA O1 superfamily Conus aurisiacus DGCSNAGAFCGIHOGLCCSEICIVWCT
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(Btr)EPWC(nh2)
P01811 Bromosleeper peptide O3 superfamily Conus radiatus (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW
QCV(Gla)ACPV
P07497 Bru9a Conus brunneus SCGGSCFGGCWOGCSCYARTCFRD
P07498 Bru9a-GLP cyclic synthetic construct SCGGSCFGGCWOGCSCYARTCFRDGLP
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
HP(nh2)
P04590 Bu27 Conus bullatus AO(Gla)LVVTATTTCCGYDOMTICOOCMCTHSCOOKRKO(nh2)
P05869 BuIA[P6O] synthetic construct GCCSTOPCAVLYC(nh2)
P05870 BuIA[P7O] synthetic construct GCCSTPOCAVLYC(nh2)
P01627 BVIA O1 superfamily Conus bullatus DECSAOGAFCLIROGLCCSEFCFFACF
P04080 C4.1 A superfamily Conus catus QKELVPSTITTCCGNEPGTMCPKCMCDNTCOPKKKKRP
P03087 C6.1 O1 superfamily Conus catus YGCSNAGAFCGIHOGLCCSELCLGWCT
P08523 C8.4 S superfamily Conus catus ZYPLGCOGTCGKGGKCVGTCECTNYTNCYCSSKGFREPGCS
CTCPT
P02825 Ca15a O2 superfamily Conus caracteristicus (characteristic cone) CRVENKCOHTVCCDRSRCSCKLIRTRPLMYHVCVC
P04136 Cal5.1 L1a Divergent MRFYIGLMAA Conus californicus DAADVKOVARTNEGOGRDOAOCCQHPIETCC
P04260 Cal5.1 L1b Divergent MRFYIGLMAA Conus californicus TNEGOGRDOAOCCQHPIETCC
P04261 Cal5.1 L2a Divergent MRFYIGLMAA Conus californicus DAADVKOVARQNEGOGRDOAOCCQHPIETCC
P04262 Cal5.1 L2b Divergent MRFYIGLMAA Conus californicus QNEGOGRDOAOCCQHPIETCC
P04263 Cal5.1 L3a Divergent MRFYIGLMAA Conus californicus DAADVKOVARHNDGOGRDOAOCCQHPIETCC
P04264 Cal5.1 L3b Divergent MRFYIGLMAA Conus californicus HNDGOGRDOAOCCQHPIETCC
P04920 Cal6.17b Conus californicus GDACSLLNGDDCGOGELCCTOSGDHQGTCETSCW
P04265 Cal6.4c O1 superfamily Conus californicus GC(Btr)LCLGONACCRGSVCHDYCPS
P04922 Cal9.8 Conus californicus DDETTFPCNSGRCACLOEDSHSYTCQSO
P04916 CalTx-2 Conus californicus SLCDKOHHNCIDGQTCYHTCCQNGLKCVRYO
P04917 CalXXIXA Conus californicus ROKCCCVCGVVGRKCCSTWDKCHOVHLOCOSS(nh2)
P02840 CaXVIIA Y superfamily Conus caracteristicus (characteristic cone) CGGTGDSCNEOAGELCCRRLKCVNSRCCPTTDGC
P01510 CcTx A superfamily Conus consors AOWLVP(gSr)QITTCCGYNOGTMCOSCMCTNTC
P01537 CMrVIA Conus marmoreus VCCGYKLCHOC
P02854 CMrVIA [K6P] synthetic construct VCCGYPLCHOC
P02855 CMrVIA [K6P] amidated synthetic construct VCCGYPLCHOC(nh2)
P02856 CMrVIA amidated synthetic construct VCCGYKLCHOC(nh2)
P01738 CMrX T superfamily Conus marmoreus GICCGVSFCYOC
P05348 CnID A superfamily Conus consors CCHOACGKHFNC
P05353 CnIK Conus consors NGRCCHOACGKYYSC(nh2)
P03996 CnVIB Conus consors DECFSOGTFCGTKOGLCCSARCFSFFCISLEF(nh2)
P03997 CnVIC Conus consors DECFSOGTFCGIKOGLCCSARCFSFFCISLEF(nh2)
P03998 CnVID Conus consors DECFSOGTFCGFKOGLCCSARCFSFFCISLEF(nh2)
P01632 CnVIIA O1 superfamily Conus consors CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2)
P05232 CnVIIC O1 superfamily Conus consors CKGTGKOCSRIAYNCCTGSCRSGKC(nh2)
P06934 Con-ins G1 B chain Insulin superfamily Conus geographus (Geography cone) TFDTOKHRCGS(Gla)ITNSYMDLCYR
P06937 Con-ins G3 A chain Insulin superfamily Conus geographus (Geography cone) GIV(Gla)VCCDNOCTVATLRTFCH
P07643 conantokin-G[+10O] synthetic construct GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2)
P05841 Conantokin-Rl2 B1 superfamily Conus rolani GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05847 Conantokin-Rl2[K8Nle] synthetic construct GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA
N(nh2)
P05844 Conantokin-Rl2[L5Y] synthetic construct GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P08527 Conkunitzin-C1 Conus catus DRPSYCNLOADSGSGTNREQRIYYNSARKQCLTFPYKGKGG
NANNFSRTNDCRRTCQYPAA
P08991 Conomarphin Eb1 Conus eburneus GWVYHAHPEONSfWT
P08996 Conomarphin Eb1[f13A] synthetic construct GWVYHAHPEONSAWT
P08997 Conomarphin Eb1[f13F] synthetic construct GWVYHAHPEONSFWT
P08909 conomarphin-Ac1 M superfamily Conus achatinus NYYLYOAROENSwwT
P08923 conomarphin-Ac1 amidated synthetic construct NYYLYOAROENSwwT(nh2)
P08925 conomarphin-Ac1[E10(Gla), W14(Gla)] synthetic construct NYYLYOARO(Gla)NSw(Gla)T
P08926 conomarphin-Ac1[E10(Gla), W14(Gla)] amidated synthetic construct NYYLYOARO(Gla)NSw(Gla)T(nh2)
P08924 conomarphin-Ac1[E10(Gla)] synthetic construct NYYLYOARO(Gla)NSwwT
P08917 conomarphin-Ac1[E10A] synthetic construct NYYLYOAROANSwwT
P08914 conomarphin-Ac1[L4A] synthetic construct NYYAYOAROENSwwT
P08919 conomarphin-Ac1[N11A] synthetic construct NYYLYOAROEASwwT
P08911 conomarphin-Ac1[N1A] synthetic construct AYYLYOAROENSwwT
P08916 conomarphin-Ac1[O6A] synthetic construct NYYLYAAROENSwwT
P08910 conomarphin-Ac1[O6P] M superfamily Conus achatinus NYYLYPAROENSwwT
P08918 conomarphin-Ac1[O9A] synthetic construct NYYLYOARAENSwwT
P08928 conomarphin-Ac1[R8A] synthetic construct NYYLYOAAOENSwwT
P08920 conomarphin-Ac1[S12A] synthetic construct NYYLYOAROENAwwT
P08915 conomarphin-Ac1[T15A] synthetic construct NYYLYOAROENSwwA
P08921 conomarphin-Ac1[W13A] synthetic construct NYYLYOAROENSAwT
P08922 conomarphin-Ac1[W14A] synthetic construct NYYLYOAROENSwAT
P08913 conomarphin-Ac1[Y2A] synthetic construct NAYLYOAROENSwwT
P08912 conomarphin-Ac1[Y3A] synthetic construct NYALYOAROENSwwT
P08927 conomarphin-Ac1[Y5A] synthetic construct NYYLAOAROENSwwT
P04218 Conomarphin-Im1 M superfamily Conus imperialis DWEYHAHPKONSfWT
P02835 conomarphin-Mr1 M superfamily Conus marmoreus DWEYHAHPKONSfWT
P05440 conomarphin-Mr2 M superfamily Conus marmoreus DWVNHAHOQONSIWS
P02481 Conophan-mus-V Conus mus SOANS(hVa)WS
P03726 conopressin-Tx Conus textile (Cloth-of-gold cone) CFIRNCPO
P01268 conotoxin-GS O1 superfamily Conus geographus (Geography cone) ACSGRGSRCOOQCCMGLRCGRGNPQKCIGAH(Gla)DV
P01270 Contryphan-Am O2 superfamily Conus amadis GCOwDPWC(nh2)
P08778 Contryphan-Am Conus amadis GCOwDPWC(nh2)
P08776 Contryphan-Be Conus betulinus VVGCOwQPWC(nh2)
P04624 Contryphan-Bu O2 superfamily Conus bullatus KCOwSPWC(nh2)
P08777 Contryphan-Fi Conus figulinus VVGCOwQPWC(nh2)
P06830 Contryphan-Fia Conus figulinus GCODWQPWC
P06828 Contryphan-Fib Conus figulinus GCOWMPWC(nh2)
P02621 Contryphan-Lt O2 superfamily Conus litteratus GCOwEPWC(nh2)
P02597 Contryphan-P O2 superfamily Conus purpurascens GCOwDPWC(nh2)
P01372 Contryphan-R O2 superfamily Conus radiatus GCOwEP(Btr)C(nh2)
P01355 Contryphan-R [Des-Gly1] synthetic construct COwQPWC(nh2)
P03549 Contryphan-S O2 superfamily Conus striatus (Striated cone) GCOwEPWC(nh2)
P01318 Contryphan-Sm O2 superfamily Conus stercusmuscarum GCOwQPWC(nh2)
P02622 Contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) GCOwQPYC(nh2)
P07557 Contryphan-Ze Conus zeylanicus VVGCOwQPWC(nh2)
P03591 Cp20.3 D superfamily Conus capitaneus (Gla)VQ(Gla)CQVDTOGSSWGKCCMTRMCGTMCCSRSVC
TCVYHWRRGHGCSCPG
P03595 Cp20.5 D superfamily Conus capitaneus DNEA(Gla)CQIDTOGSSWGKCCMTRMCGTMCCSRSVCTCV
YHWRRGHGCSCPG
P01625 CVIE-2 O1 superfamily Conus catus YGCSNAGAFCGIHOGLCCSELCLVWCT
P01262 Cyclic contryphan synthetic construct GCOyNPKC(nh2)
P02848 Cyclic MrIA synthetic construct NGVCCGYKLCHOCAG
P02550 De13a Conus delessertii DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG
CTH(nh2)
P05522 De13b G superfamily Conus delessertii DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVRQHCSGCNH(nh2)
P03629 De7b Conus delessertii DCIOGG(Gla)NCDVFROYRCCSGYCILLLCA
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P02843 Di19A Divergent MSTLGMTLL- Conus distans GCDOTDGCQTTVC(Gla)TDTGOCCCKPNFTCQISNSGTKS
CSCSGQOSDCOV
P00050 EI A superfamily Conus ermineus (Atlantic fish-hunting cone) RDOCCYHPTCNMSNPQIC(nh2)
P09022 EI[D2A] synthetic construct RAOCCYHPTCNMSNPQIC(nh2)
P09036 EI[del1-2] synthetic construct OCCYHPTCNMSNPQIC(nh2)
P09035 EI[del1] synthetic construct DOCCYHPTCNMSNPQIC(nh2)
P09025 EI[H7A] synthetic construct RDOCCYAPTCNMSNPQIC(nh2)
P09034 EI[I17A] synthetic construct RDOCCYHPTCNMSNPQAC(nh2)
P09029 EI[M12A] synthetic construct RDOCCYHPTCNASNPQIC(nh2)
P09028 EI[N11A] synthetic construct RDOCCYHPTCAMSNPQIC(nh2)
P09031 EI[N14A] synthetic construct RDOCCYHPTCNMSAPQIC(nh2)
P09032 EI[P15A] synthetic construct RDOCCYHPTCNMSNAQIC(nh2)
P09026 EI[P8A] synthetic construct RDOCCYHATCNMSNPQIC(nh2)
P09033 EI[Q16A] synthetic construct RDOCCYHPTCNMSNPAIC(nh2)
P09021 EI[R1A] synthetic construct ADOCCYHPTCNMSNPQIC(nh2)
P09030 EI[S13A] synthetic construct RDOCCYHPTCNMANPQIC(nh2)
P09027 EI[T9A] synthetic construct RDOCCYHPACNMSNPQIC(nh2)
P09024 EI[Y6A] synthetic construct RDOCCAHPTCNMSNPQIC(nh2)
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P07538 EIIB Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWHPACGKNRC(nh2)
P01635 EIVA Conus ermineus (Atlantic fish-hunting cone) GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2)
P01740 EIVB Conus ermineus (Atlantic fish-hunting cone) GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2)
P01561 EVIA O1 superfamily Conus ermineus (Atlantic fish-hunting cone) DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2)
P01575 EVIB O1 superfamily Conus ermineus (Atlantic fish-hunting cone) EACYOOGTFCGIKOGLCCSELCLPAVCVG(nh2)
P06824 Fi3b M superfamily Conus figulinus CCSQDCRVCIOCCPY
P07899 Fr3.1 M superfamily Conus frigidus ZQ(Gla)CCDODWCDGACYNCC
P00098 GID A superfamily Conus geographus (Geography cone) IRD(Gla)CCSNPACRVNNOHVC
P03561 GID [(Gla)4A] synthetic construct IRDACCSNPACRVNNOHVC
P08779 GID [(Gla)4E, A10Q] synthetic construct IRDECCSNPQCRVNNOHVC
P07544 GID [(Gla)4E, A10S] synthetic construct IRDECCSNPSCRVNNOHVC
P07545 GID [(Gla)4E, A10T] synthetic construct IRDECCSNPTCRVNNOHVC
P07502 GID [(Gla)4E, A10V] synthetic construct IRDECCSNPVCRVNNOHVC
P07553 GID [(Gla)4E, N15H] synthetic construct IRDECCSNPACRVNHOHVC
P07552 GID [(Gla)4E, N15K] synthetic construct IRDECCSNPACRVNKOHVC
P07546 GID [(Gla)4E, V13F] synthetic construct IRDECCSNPACRFNNOHVC
P07549 GID [(Gla)4E, V13I] synthetic construct IRDECCSNPACRINNOHVC
P08780 GID [(Gla)4E, V13I] synthetic construct IRDECCSNPACRINNOHVC
P07548 GID [(Gla)4E, V13L] synthetic construct IRDECCSNPACRLNNOHVC
P07550 GID [(Gla)4E, V13S] synthetic construct IRDECCSNPACRSNNOHVC
P07551 GID [(Gla)4E, V13T] synthetic construct IRDECCSNPACRTNNOHVC
P07547 GID [(Gla)4E, V13W] synthetic construct IRDECCSNPACRWNNOHVC
P07503 GID [(Gla)4E, V13Y] synthetic construct IRDECCSNPACRYNNOHVC
P07556 GID [(Gla)4E, V18N] synthetic construct IRDECCSNPACRVNNOHNC
P07555 GID [(Gla)4E, V18Q] synthetic construct IRDECCSNPACRVNNOHQC
P07554 GID [(Gla)4E, V18Y] synthetic construct IRDECCSNPACRVNNOHYC
P03553 GID [(Gla)4E] synthetic construct IRDECCSNPACRVNNOHVC
P07542 GID [(Gla)4Q] synthetic construct IRDQCCSNPACRVNNOHVC
P03560 GID [D3A,(Gla)4E] synthetic construct IRAECCSNPACRVNNOHVC
P07541 GID [D3N, (Gla)4E] synthetic construct IRNECCSNPACRVNNOHVC
P07543 GID [D3N,E4Q] synthetic construct IRNQCCSNPACRVNNOHVC
P03558 GID [I1A, (Gla)4E] synthetic construct ARDECCSNPACRVNNOHVC
P04481 GID [R12A] synthetic construct IRD(Gla)CCSNPACAVNNOHVC
P03559 GID [R2A, (Gla)4E] synthetic construct IADECCSNPACRVNNOHVC
P07540 GID [R2K, (Gla)4E] synthetic construct IKDECCSNPACRVNNOHVC
P03557 GID amidated [(GLA)4E] synthetic construct IRDECCSNPACRVNNOHVC(nh2)
P03571 GID[(GLA)4E, H17A] synthetic construct IRDECCSNPACRVNNOAVC
P03567 GID[(GLA)4E, N14A] synthetic construct IRDECCSNPACRVANOHVC
P03568 GID[(GLA)4E, N15A] synthetic construct IRDECCSNPACRVNAOHVC
P03563 GID[(GLA)4E, N8A] synthetic construct IRDECCSAPACRVNNOHVC
P03564 GID[(GLA)4E, P9A] synthetic construct IRDECCSNAACRVNNOHVC
P03562 GID[(GLA)4E, S7A] synthetic construct IRDECCANPACRVNNOHVC
P03566 GID[(GLA)4E, V13A] synthetic construct IRDECCSNPACRANNOHVC
P03572 GID[(GLA)4E, V18A] synthetic construct IRDECCSNPACRVNNOHAC
P03573 GID[del1, R2A, (GLA)4E] synthetic construct ADECCSNPACRVNNOHVC
P03574 GID[Del1-2,D3A, (GLA)4E] synthetic construct AECCSNPACRVNNOHVC
P03576 GID[Del1-3, (GLA)4A] synthetic construct ACCSNPACRVNNOHVC
P03575 GID[Del1-3, (GLA)4E] synthetic construct ECCSNPACRVNNOHVC
P03577 GID[Del4] synthetic construct CCSNPACRVNNOHVC
P03565 GID[R12A] synthetic construct IRD(Gla)CCSNPACRVNNOHVC
P01571 GIIIA M superfamily Conus geographus (Geography cone) RDCCTOOKKCKDRQCKOQRCCA(nh2)
P07484 GIIIA [A10C, A21C] M superfamily Conus geographus (Geography cone) RDCCTOOKKAKDRQCKOQRCAA(nh2)
P07486 GIIIA [A3C,A10C,A15C,A21C] M superfamily Conus geographus (Geography cone) RDACTOOKKAKDRQAKOQRCAA(nh2)
P07488 GIIIA [A3C,A4C,A10C,A15C,A20C,A21C] M superfamily Conus geographus (Geography cone) RDAATOOKKAKDRQAKOQRAAA(nh2)
P07485 GIIIA [A3C,A4C,A15C,A20C] M superfamily Conus geographus (Geography cone) RDAATOOKKCKDRQAKOQRACA(nh2)
P07482 GIIIA [A3C] M superfamily Conus geographus (Geography cone) RDACTOOKKCKDRQAKOQRCCA(nh2)
P07487 GIIIA [A4C,A10C,A20C,A21C] M superfamily Conus geographus (Geography cone) RDCATOOKKAKDRQCKOQRAAA(nh2)
P07483 GIIIA [A4C,C20A] M superfamily Conus geographus (Geography cone) RDCATOOKKCKDRQCKOQRACA(nh2)
P01570 GIIIA [R13A] synthetic construct RDCCTOOKKCKDAQCKOQRCCA(nh2)
P01566 GIIIB M superfamily Conus geographus (Geography cone) RDCCTOORKCKDRRCKOMKCCA(nh2)
P01744 GIIIC Conus geographus (Geography cone) RDCCTOOKKCKDRRCKOLKCCA(nh2)
P01511 Gla(1)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla)
GSCTM(Btr)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02847 Gla(3)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) LCODYT(Gla)OCSHAH(Gla)CCSWNCYNGHCTG
P01546 GVIA O1 superfamily Conus geographus (Geography cone) CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2)
P01780 GVIA [O10>K] synthetic construct CKSOGSSCSKTSYNCCRSCNOYTKRCY(nh2)
P05701 GVIA[C8U,C19U] synthetic construct CKSOGSSUSOTSYNCCRSUNOYTKRCY(nh2)
P01743 GVIIA O1 superfamily Conus geographus (Geography cone) CKSOGTOCSRGMRDCCTSCLLYSNKCRRY
P02581 GVIIB Conus geographus (Geography cone) CKSOGTOCSRGMRDCCTSCLSYSNKCRRY
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG
CACS(nh2)
P06822 GVIIJ O1 superfamily Conus geographus (Geography cone) G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS
SA
P06955 GVIIJ covalent dimer synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYTKTCKDKSSA
P08797 GVIIJ[(Btr)2A,(Scc)24(Eac)] synthetic construct GACGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08818 GVIIJ[(Btr)2W,(Scc)24(Eac),D31K] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKKKSSA
P08814 GVIIJ[(Btr)2W,(Scc)24(Eac),K27D] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTDTCKDKSSA
P08816 GVIIJ[(Btr)2W,(Scc)24(Eac),K27F] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTFTCKDKSSA
P08815 GVIIJ[(Btr)2W,(Scc)24(Eac),K27G] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTGTCKDKSSA
P08819 GVIIJ[(Btr)2W,(Scc)24(Eac),K32D] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDDSSA
P08810 GVIIJ[(Btr)2W,(Scc)24(Eac),Y25A] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)ATKTCKDKSSA
P08812 GVIIJ[(Btr)2W,(Scc)24(Eac),Y25D] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)DTKTCKDKSSA
P08811 GVIIJ[(Btr)2W,(Scc)24(Eac),Y25R] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)RTKTCKDKSSA
P06951 GVIIJ[(Btr)2W,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P06954 GVIIJ[(Btr)2W,(Scc)24(Msc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Msc)YTKTCKDKSSA
P06834 GVIIJ[(Btr)2W,(Scc)24(Sgc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Sgc)YTKTCKDKSSA
P06953 GVIIJ[(Btr)2W,(Scc)24(Smc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Smc)YTKTCKDKSSA
P06952 GVIIJ[(Btr)2W,(Scc)24(Tcc)] synthetic construct GWCGDOGATCGKLRLYCCSGFCD(Tcc)YTKTCKDKSSA
P08813 GVIIJ[(Btr)2W,(Scc)24C,T26A] synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYAKTCKDKSSA
P08817 GVIIJ[(Btr)2W,(Scc)24C,T28A] synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYTKACKDKSSA
P06833 GVIIJ[(Btr)2W,(Scc)24C] synthetic construct GWCGDOGATCGKLRLYCCSGFCDCYTKTCKDKSSA
P06956 GVIIJ[(Btr)2W,(Scc)24S] synthetic construct GWCGDOGATCGKLRLYCCSGFCDSYTKTCKDKSSA
P08808 GVIIJ[(Btr)2W,D23(Gla),(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFC(Gla)(Eac)YTKTCKDKS
SA
P08809 GVIIJ[(Btr)2W,D23N,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFCN(Eac)YTKTCKDKSSA
P08798 GVIIJ[(Btr)2W,D5K,(Scc)24(Eac)] synthetic construct GWCGKOGATCGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08807 GVIIJ[(Btr)2W,F21A,(Scc)24C] synthetic construct GWCGDOGATCGKLRLYCCSGACDCYTKTCKDKSSA
P08801 GVIIJ[(Btr)2W,K12D,(Scc)24(Eac)] synthetic construct GWCGDOGATCGDLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08802 GVIIJ[(Btr)2W,L13A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKARLYCCSGFCD(Eac)YTKTCKDKSSA
P08804 GVIIJ[(Btr)2W,L15A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRAYCCSGFCD(Eac)YTKTCKDKSSA
P08803 GVIIJ[(Btr)2W,R14D,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLDLYCCSGFCD(Eac)YTKTCKDKSSA
P08806 GVIIJ[(Btr)2W,S19A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCAGFCD(Eac)YTKTCKDKSSA
P08800 GVIIJ[(Btr)2W,T9A,(Scc)24(Eac)] synthetic construct GWCGDOGAACGKLRLYCCSGFCD(Eac)YTKTCKDKSSA
P08805 GVIIJ[(Btr)2W,Y16A,(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLACCSGFCD(Eac)YTKTCKDKSSA
P06835 GVIIJ[(Btr)2W] O1 superfamily GWCGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKSSA
P04418 ImI [P60] synthetic construct GCCSDORCAWRC(nh2)
P02625 LtIIIA M superfamily Conus litteratus D(Gla)CC(Gla)OQWCDGACDCCS
P02857 marmophin [d13>D] synthetic construct DWEYHAHPKONSFWT
P03607 Mi20.1 D superfamily Conus miles DVQ(Gla)CQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGKGHGCSC
P03609 Mi20.2 D superfamily Conus miles DVQ(Gla)CQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGRGHGCSC
P03611 Mi20.3 D superfamily Conus miles DAQGCQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIYHRGR
GHGCSC
P03613 Mi20.4 D superfamily Conus miles DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGR
GHGCSC
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
COOKRKO(nh2)
P07647 MoVIA O1 superfamily Conus moncuri CKPOGSKCSOSMRDCCTTCISYTKRCRKYYN
P07646 MoVIB O1 superfamily Conus moncuri CKPOGSKCSOSMRDCCTTCISYTKRCRKYY
P07649 MoVIB[R13Y] synthetic construct CKPOGSKCSOSMYDCCTTCISYTKRCRKYY
P05459 Mr062 O1 superfamily Conus marmoreus CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC
AT(Btr)LDL
P04662 Mr1.8 A superfamily Conus marmoreus ROECCTHOACHVSNPELCS
P05484 Mr10.2 T superfamily Conus marmoreus ACCVYKICYOC
P05367 Mr11.1 I1 superfamily Conus marmoreus DKWGTCSLLGKGCRHHSDCCWDLCCTGKTCVMTVLOCLFLS
LIVRWT
P05487 Mr15.1 N superfamily Conus marmoreus CSSGKTCGSVEOVLCCARSDCYCRLIQTRSYWVOICVCP
P05489 Mr15.2 N superfamily Conus marmoreus CRSGKTCORVGODVCC(Gla)RSDCFCKLVOARPFWRYRCI
CL
P05416 Mr3.11 M superfamily Conus marmoreus CCRIACNLKCNOCC(nh2)
P02687 Mr3.4 M superfamily Conus marmoreus SKQCCHLPACRFGCTOCCW
P05380 Mr6.16 O2 superfamily Conus marmoreus TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL
P05495 Mr6.23 H superfamily Conus marmoreus STDCNGVOCQFGCCVTINGNDECRELDC
P05514 Mr6.24 H superfamily Conus marmoreus STDCNGVOCEFGCCVTINGNDECREIGCE
P05503 Mr6.26 H superfamily Conus marmoreus IEEDCGYVOCEFGCCRIIDGKEKCREIDCQ
P01384 MrIA T superfamily Conus marmoreus NGVCCGYKLCHOC
P08720 MrIA [del1,Y7Sty] synthetic construct GVCCG(sTy)KLCHOC
P08715 MrIA [del1-2] synthetic construct VCCGYKLCHOC
P08716 MrIA [del1-4] synthetic construct CGYKLCHOC
P08717 MrIA [del1-5] synthetic construct GYKLCHOC
P08718 MrIA [del1-6] synthetic construct YKLCHOC
P07576 MrIA [insN_(Hfe)] synthetic construct (HFE)NGVCCGYKLCHOC(nh2)
P08714 MrIA [insN_LR] synthetic construct LRNGVCCGYKLCHOC
P07575 MrIA [insN_W] synthetic construct WNGVCCGYKLCHOC(nh2)
P07571 MrIA [N1(Abz)] synthetic construct (ABZ)GVCCGYKLCHOC(nh2)
P07560 MrIA [N1(Bhk)] synthetic construct (BHK)GVCCGYKLCHOC(nh2)
P07568 MrIA [N1(Cit)] synthetic construct (Cit)GVCCGYKLCHOC(nh2)
P07574 MrIA [N1(Dmf)] synthetic construct (DMF)GVCCGYKLCHOC(nh2)
P07563 MrIA [N1(Nle)] synthetic construct (Nle)GVCCGYKLCHOC(nh2)
P07565 MrIA [N1A] synthetic construct AGVCCGYKLCHOC(nh2)
P07570 MrIA [N1D] synthetic construct DGVCCGYKLCHOC(nh2)
P07567 MrIA [N1F] synthetic construct FGVCCGYKLCHOC(nh2)
P07564 MrIA [N1G] synthetic construct GGVCCGYKLCHOC(nh2)
P07566 MrIA [N1I] synthetic construct IGVCCGYKLCHOC(nh2)
P07561 MrIA [N1k] synthetic construct kGVCCGYKLCHOC(nh2)
P07572 MrIA [N1n] synthetic construct nGVCCGYKLCHOC(nh2)
P07569 MrIA [N1Q] synthetic construct QGVCCGYKLCHOC(nh2)
P07558 MrIA [N1R] synthetic construct RGVCCGYKLCHOC(nh2)
P07559 MrIA [N1r] synthetic construct rGVCCGYKLCHOC(nh2)
P07562 MrIA [N1S] synthetic construct SGVCCGYKLCHOC(nh2)
P07573 MrIA [N1T] synthetic construct TGVCCGYKLCHOC(nh2)
P07635 MrIA [N1Z, C10c] synthetic construct ZGVCCGYKLcHOC(nh2)
P07637 MrIA [N1Z, C13c] synthetic construct ZGVCCGYKLCHOc(nh2)
P07639 MrIA [N1Z, C4(Hcy), C5(Hcy), C10(Hcy), C13(Hcy)] synthetic construct ZGV(Hcy)(Hcy)GYKL(Hcy)HO(Hcy)(nh2)
P07636 MrIA [N1Z, C4c, C13c] synthetic construct ZGVcCGYKLCHOc(nh2)
P07633 MrIA [N1Z, C4c, C5c, C10c, C13c] synthetic construct ZGVccGYKLcHOc(nh2)
P07638 MrIA [N1Z, C4c] synthetic construct ZGVcCGYKLCHOC(nh2)
P07634 MrIA [N1Z, C5c, C10c] synthetic construct ZGVCcGYKLcHOC(nh2)
P07640 MrIA [N1Z, Y7(Mty), H11W] synthetic construct ZGVCCG(Mty)KLCWOC(nh2)
P07641 MrIA [N1Z, Y7(Mty), L9(Cha), H11W] synthetic construct ZGVCCG(Mty)K(Cha)CWOC(nh2)
P07621 MrIA [N1Z,H11(Bta)] synthetic construct ZGVCCGYKLC(BTA)OC(nh2)
P07616 MrIA [N1Z,H11(Fla)] synthetic construct ZGVCCGYKLC(FLA)OC(nh2)
P07620 MrIA [N1Z,H11(Nal)] synthetic construct ZGVCCGYKLC(Nal)OC(nh2)
P07617 MrIA [N1Z,H11(Pya)] synthetic construct ZGVCCGYKLC(PYA)OC(nh2)
P07625 MrIA [N1Z,H11E] synthetic construct ZGVCCGYKLCEOC(nh2)
P07615 MrIA [N1Z,H11F] synthetic construct ZGVCCGYKLCFOC(nh2)
P07622 MrIA [N1Z,H11h] synthetic construct ZGVCCGYKLChOC(nh2)
P07624 MrIA [N1Z,H11L] synthetic construct ZGVCCGYKLCLOC(nh2)
P07623 MrIA [N1Z,H11P] synthetic construct ZGVCCGYKLCPOC(nh2)
P07626 MrIA [N1Z,H11Q] synthetic construct ZGVCCGYKLCQOC(nh2)
P07614 MrIA [N1Z,H11R] synthetic construct ZGVCCGYKLCROC(nh2)
P07619 MrIA [N1Z,H11W] synthetic construct ZGVCCGYKLCWOC(nh2)
P07618 MrIA [N1Z,H11Y] synthetic construct ZGVCCGYKLCYOC(nh2)
P07603 MrIA [N1Z,K8(Cit)] synthetic construct ZGVCCGY(Cit)LCHOC(nh2)
P07596 MrIA [N1Z,K8(Hly)] synthetic construct ZGVCCGY(HLY)LCHOC(nh2)
P07602 MrIA [N1Z,K8(Nle)] synthetic construct ZGVCCGY(Nle)LCHOC(nh2)
P07595 MrIA [N1Z,K8(Orn)] synthetic construct ZGVCCGY(Orn)LCHOC(nh2)
P07601 MrIA [N1Z,K8E] synthetic construct ZGVCCGYELCHOC(nh2)
P07600 MrIA [N1Z,K8I] synthetic construct ZGVCCGYILCHOC(nh2)
P07594 MrIA [N1Z,K8k] synthetic construct ZGVCCGYkLCHOC(nh2)
P07599 MrIA [N1Z,K8L] synthetic construct ZGVCCGYLLCHOC(nh2)
P07598 MrIA [N1Z,K8Q] synthetic construct ZGVCCGYQLCHOC(nh2)
P07597 MrIA [N1Z,K8R] synthetic construct ZGVCCGYRLCHOC(nh2)
P07604 MrIA [N1Z,K8W] synthetic construct ZGVCCGYWLCHOC(nh2)
P07608 MrIA [N1Z,L9(Cha)] synthetic construct ZGVCCGYK(Chg)CHOC(nh2)
P07607 MrIA [N1Z,L9(Hle)] synthetic construct ZGVCCGYK(HLE)CHOC(nh2)
P07606 MrIA [N1Z,L9(Nle)] synthetic construct ZGVCCGYK(Nle)CHOC(nh2)
P07610 MrIA [N1Z,L9I] synthetic construct ZGVCCGYKICHOC(nh2)
P07611 MrIA [N1Z,L9P] synthetic construct ZGVCCGYKPCHOC(nh2)
P07609 MrIA [N1Z,L9Q] synthetic construct ZGVCCGYKQCHOC(nh2)
P07612 MrIA [N1Z,L9R] synthetic construct ZGVCCGYKRCHOC(nh2)
P07613 MrIA [N1Z,L9S] synthetic construct ZGVCCGYKSCHOC(nh2)
P07605 MrIA [N1Z,L9V] synthetic construct ZGVCCGYKVCHOC(nh2)
P07582 MrIA [N1Z,Y7(Cha)] synthetic construct ZGVCCG(Cha)KLCHOC(nh2)
P07577 MrIA [N1Z,Y7(Dmk)] synthetic construct ZGVCCG(DMF)KLCHOC(nh2)
P07578 MrIA [N1Z,Y7(Dpa)] synthetic construct ZGVCCG(DPA)KLCHOC(nh2)
P07579 MrIA [N1Z,Y7(Hly)] synthetic construct ZGVCCG(HLY)KLCHOC(nh2)
P07581 MrIA [N1Z,Y7(Mty)] synthetic construct ZGVCCG(Mty)KLCHOC(nh2)
P07593 MrIA [N1Z,Y7(Thi)] synthetic construct ZGVCCG(THI)KLCHOC(nh2)
P07584 MrIA [N1Z,Y7E] synthetic construct ZGVCCGEKLCHOC(nh2)
P07580 MrIA [N1Z,Y7F] synthetic construct ZGVCCGFKLCHOC(nh2)
P07585 MrIA [N1Z,Y7I] synthetic construct ZGVCCGIKLCHOC(nh2)
P07586 MrIA [N1Z,Y7K] synthetic construct ZGVCCGKKLCHOC(nh2)
P07587 MrIA [N1Z,Y7L] synthetic construct ZGVCCGLKLCHOC(nh2)
P07588 MrIA [N1Z,Y7P] synthetic construct ZGVCCGPKLCHOC(nh2)
P07589 MrIA [N1Z,Y7Q] synthetic construct ZGVCCGQKLCHOC(nh2)
P07590 MrIA [N1Z,Y7R] synthetic construct ZGVCCGRKLCHOC(nh2)
P07591 MrIA [N1Z,Y7S] synthetic construct ZGVCCGSKLCHOC(nh2)
P07583 MrIA [N1Z,Y7W] synthetic construct ZGVCCGWKLCHOC(nh2)
P07592 MrIA [N1Z,Y7y] synthetic construct ZGVCCGyKLCHOC(nh2)
P06932 MrIA [N1Z] synthetic construct ZGVCCGYKLCHOC(nh2)
P04492 MrIA amidated synthetic construct NGVCCGYKLCHOC(nh2)
P01737 MrIB T superfamily Conus marmoreus VGVCCGYKLCHOC
P02849 MrIB amidated synthetic construct VGVCCGYKLCHOC(nh2)
P01422 MrIIIA M superfamily Conus marmoreus GCCGSFACRFGCVOCCV
P01465 MrIIIB M superfamily Conus marmoreus SKQCCHLAACRFGCTOCCW
P01486 MrIIIC M superfamily Conus marmoreus CCAPSACRLGCROCCR
P02696 MrIIID M superfamily Conus marmoreus CCRLSCGLGCHOCC(nh2)
P02698 MrIIIG M superfamily Conus marmoreus DCCOLPACPFGCNOCC(nh2)
P03597 Ms20.1 D superfamily Conus mustelinus DVR(Gla)CNINTOGSSWGKCCLTRMCGPMCCARSGCTCVY
HWRRGHGCSCPG
P03599 Ms20.2 D superfamily Conus mustelinus DVR(Gla)CNINTOGSSWGKCCLTRMCGTMCCARSGCTCVY
HWRRGHGCSCPG
P03601 Ms20.3 D superfamily Conus mustelinus DVR(Gla)CQVNTOGSSWGKCCMTRMCGTMCCARSGCTCVY
HWRRGHGCSCPG
P03603 Ms20.4 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCMTRMCGTMCCARSGCTCV
YHWRRGHGCSCPG
P03605 Ms20.5 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCLTRMCGPMCCARSGCTCV
YHWRRGHGCSCPG
P01624 MVIA O1 superfamily Conus magus (Magus cone)
Conus catus
DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2)
P01623 MVIB O1 superfamily Conus magus (Magus cone) EACYNAGSFCGIHOGLCCSEFCILWCITFVDS(nh2)
P01622 MVIC O1 superfamily Conus magus (Magus cone) DECYPPGTFCGIKOGLCCSAICLSFVCISFDF
P01621 MVID O1 superfamily Conus magus (Magus cone) EACYNAGTFCGIKOGLCCSAICLSFVCISFDF
P01519 NgVIA Conus nigropunctatus SKCFSOGTFCGIKOGLCCSVRCFSLFCISFE
P01397 OIVA A superfamily Conus obscurus CCGVONAACHOCVCKNTC(nh2)
P04446 OIVA [H10P] synthetic construct CCGVONAACPOCVCKNTC(nh2)
P04447 OIVA [K15N] synthetic construct CCGVONAACHOCVCNNTC(nh2)
P01688 OIVB A superfamily Conus obscurus CCGVONAACPOCVCNKTCG(nh2)
P04061 P21a Conus purpurascens FELLPSQDRSCCIQKTLECLENYOGQASQRAHYCQQDATTN
CODTYYFGCCPGYATCMSINAGNNVRSAFDKCINRLCFDPG
H(nh2)
P06789 PeIA[P13O] synthetic construct GCCSHPACSVNHOELC(nh2)
P06784 PeIA[P6O] synthetic construct GCCSHOACSVNHPELC(nh2)
P01689 PeIVA A superfamily Conus pergrandis CCGVONAACHOCVCTGKC
P01687 PeIVB A superfamily Conus pergrandis CCGIONAACHOCVCTGKC
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P08506 PIC [O7P] Conus purpurascens SGCCKHOACGKNRC
P02228 PIIIA M superfamily Conus purpurascens ZRLCCGFOKSCRSRQCKOHRCC(nh2)
P04296 PIIIA [G6K] synthetic construct ZRLCCKFOKSCRSRQCKOHRCC(nh2)
P04300 PIIIA [K17A] synthetic construct ZRLCCAFOKSCRSRQCAOHRCC(nh2)
P04301 PIIIA [K17Q] synthetic construct ZRLCCAFOKSCRSRQCQOHRCC(nh2)
P04294 PIIIA [K17R] synthetic construct ZRLCCGFOKSCRSRQCROHRCC(nh2)
P04297 PIIIA [R12A] synthetic construct ZRLCCAFOKSCASRQCKOHRCC(nh2)
P04293 PIIIA [R12K] synthetic construct ZRLCCGFOKSCKSRQCKOHRCC(nh2)
P04298 PIIIA [R12Q] synthetic construct ZRLCCAFOKSCQSRQCKOHRCC(nh2)
P04290 PIIIA [R14A] synthetic construct ZRLCCGFOKSCRSAQCKOHRCC(nh2)
P04292 PIIIA [R14K] synthetic construct ZRLCCGFOKSCRSKQCKOHRCC(nh2)
P04291 PIIIA [R14Q] synthetic construct ZRLCCGFOKSCRSQQCKOHRCC(nh2)
P04302 PIIIA [R20A] synthetic construct ZRLCCAFOKSCRSRQCKOHACC(nh2)
P04295 PIIIA [R2A] synthetic construct ZALCCGFOKSCRSRQCKOHRCC(nh2)
P04299 PIIIA [S13D] synthetic construct ZRLCCAFOKSCRDRQCKOHRCC(nh2)
P01611 PIIIE M superfamily Conus purpurascens HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04448 PIIIE [K9S] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04449 PIIIE [R12O,Y13F] synthetic construct HOOCCLYGKCROFOGCSSASCCQR(nh2)
P04450 PIIIE [S17Y,S18N,S20L] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P01594 PIIIF M superfamily Conus purpurascens GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04452 PIIIF [O12R,F13Y] synthetic construct GOOCCLYGSCRRYOGCYNALCCRK(nh2)
P04451 PIIIF [S9K] synthetic construct GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04453 PIIIF [Y17S,N18S,L20S] synthetic construct GOOCCLYGSCROFOGCSSASCCRK(nh2)
P01449 PIVA A superfamily Conus purpurascens GCCGSYONAACHOCSCKDROSYCGQ(nh2)
P01612 PIVA [Hyp7P,Hyp13P] synthetic construct GCCGSYPNAACHPCSCKDROSYCGQ(nh2)
P06978 PiVIIA Conus princeps (Prince cone) CDAOTHYCTNYW(Gla)CCSGYC(Gla)HSHCW
P08998 PiXXA D superfamily Conus princeps (Prince cone) AVKKTCIRSTOGSNWGRCCLTKMCHTLCCARSDCTCVYRSG
KGHGCSCTS
P04431 PnIA [P6O] synthetic construct GCCSLOPCAANNPD(sTy)C(nh2)
P01636 PnVIIA O2 superfamily Conus pennaceus DCTSWFGRCTVNS(Gla)CCSNSCDQTYC(Gla)LYAFOS
P04211 Pr3b Conus parius ERVCCGYOMSCKSRACKOSYCC(nh2)
P04213 Pr6b Conus parius FGSFIOCAHKGEOCTICCROLRCHEEKTOTCV
P04215 Pr6d Conus parius YGNFOTCSETGEDCSAMHCCRSMTCRNNICAD
P02859 PrXA C superfamily Conus parius TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2)
P04205 Pu3.4 M superfamily Conus pulicarius CCDWPCNAGCVOCCF
P02595 PVIA O1 superfamily Conus purpurascens EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2)
P01356 PVIIA O1 superfamily Conus purpurascens CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04364 PVIIA [D13A] synthetic construct CRIONQKCFQHLADCCSRKCNRFNKCV(nh2)
P04369 PVIIA [F23A] synthetic construct CRIONQKCFQHLDDCCSRKCNRANKCV(nh2)
P04359 PVIIA [F9A] synthetic construct CRIONQKCAQHLDDCCSRKCNRFNKCV(nh2)
P04360 PVIIA [F9M] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04361 PVIIA [F9Y] synthetic construct CRIONQKCYQHLDDCCSRKCNRFNKCV(nh2)
P04363 PVIIA [H11A] synthetic construct CRIONQKCFQALDDCCSRKCNRFNKCV(nh2)
P04355 PVIIA [I3A] synthetic construct CRAONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P07500 PVIIA [insN_GGG,insC_LPET] cyclic synthetic construct GGGORIPNQKCFQHLDDCCSRKCNRFNKCVLPET
P04367 PVIIA [K19A] synthetic construct CRIONQKCFQHLDDCCSRACNRFNKCV(nh2)
P04371 PVIIA [K25A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNACV(nh2)
P04357 PVIIA [K7A] synthetic construct CRIONQACFQHLDDCCSRKCNRFNKCV(nh2)
P04358 PVIIA [K7R] synthetic construct CRIONQRCFQHLDDCCSRKCNRFNKCV(nh2)
P04370 PVIIA [N24A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFAKCV(nh2)
P04362 PVIIA [Q10A] synthetic construct CRIONQKCFAHLDDCCSRKCNRFNKCV(nh2)
P04356 PVIIA [Q6A] synthetic construct CRIONAKCFQHLDDCCSRKCNRFNKCV(nh2)
P04366 PVIIA [R18A] synthetic construct CRIONQKCFQHLDDCCSAKCNRFNKCV(nh2)
P04368 PVIIA [R22A] synthetic construct CRIONQKCFQHLDDCCSRKCNAFNKCV(nh2)
P04352 PVIIA [R2A] synthetic construct CAIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04354 PVIIA [R2K] synthetic construct CKIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04353 PVIIA [R2Q] synthetic construct CQIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04365 PVIIA [S17A] synthetic construct CRIONQKCFQHLDDCCARKCNRFNKCV(nh2)
P01514 QcIIIA M superfamily Conus quercinus CCSQDCLVCIOCCPN(nh2)
P01513 QcIIIB M superfamily Conus quercinus CCSRHCWVCIOCCPN(nh2)
P01512 QcVIA O1 superfamily Conus quercinus DQSCOWCGFTCCLPNYCQGLTCTVI
P00841 R11.17 I1 superfamily Conus radiatus GOSFCKANGKOCSYHADCCNCCLSGICAOSTNWILPGCSTS
SFlKI
P01493 Reg12e M superfamily Conus regius KCCMRPICTCOCCIGP(nh2)
P01488 Reg12k M superfamily Conus regius KCCMRPICMCOCCIGAG
P00028 Reg1b/Reg1c A superfamily Conus regius GCCSDORCKHQC(nh2)
P00031 Reg1f A superfamily Conus regius DYCCRROOCTLIC(nh2)
P08570 reg3a M superfamily Conus regius GCCOOQWCGODCTSOCC
P08572 reg3c Conus regius CCAFOQWCGAGCIVOCC
P08573 reg3d Conus regius LCCOOQOCGODCASOCC
P08533 reg3e Conus regius KCCMRPICTCOCCIGP
P08538 reg3h Conus regius GCCSOWNCIQLRACOCCON(nh2)
P08561 reg3i Conus regius CCAIRLCNVYLCGSCCO
P08540 reg3j Conus regius GCCSOWNCIQLRACGCC
P08534 reg3k M superfamily Conus regius KCCMRPICMCOCCIGP(nh2)
P00030 RgIA [P6O,del13] A superfamily Conus regius GCCSDORCRYRC(nh2)
P03906 RIIIJ Conus radiatus LOOCCTOOKKHCOAOACKYKOCCKS
P04237 RIIIJΔ10-11 synthetic construct LOOCCTOOKRLCOAOACKYKOCCKS
P04234 RIIIJΔ6-11 synthetic construct LOOCCSLNLRLCOAOACKYKOCCKS
P04235 RIIIJΔ6-8 synthetic construct LOOCCSLNKKHCOAOACKYKOCCKS
P04236 RIIIJΔ9-11 synthetic construct LOOCCTOOLRLCOAOACKYKOCCKS
P02591 RIIIK M superfamily Conus radiatus LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04337 RIIIK [K18A] synthetic construct LOSCCSLNLRLCOVOACARNOCCT(nh2)
P04339 RIIIK [K18R, R19K] synthetic construct LOSCCSLNLRLCOVOACRKNOCCT(nh2)
P04333 RIIIK [L11A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04325 RIIIK [L1A] synthetic construct AOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04344 RIIIK [L1E] synthetic construct EOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04350 RIIIK [L1F] synthetic construct FOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04345 RIIIK [L1H] synthetic construct HOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04346 RIIIK [L1I] synthetic construct IOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04348 RIIIK [L1K] synthetic construct KOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04347 RIIIK [L1M] synthetic construct MOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04349 RIIIK [L1R] synthetic construct ROSCCSLNLRLCOVOACKRNOCCT(nh2)
P04351 RIIIK [L1Y] synthetic construct YOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04329 RIIIK [L7A] synthetic construct LOSCCSANLRLCOVOACKRNOCCT(nh2)
P04331 RIIIK [L9A] synthetic construct LOSCCSLNARLCOVOACKRNOCCT(nh2)
P04340 RIIIK [N20A] synthetic construct LOSCCSLNLRLCOVOACKRAOCCT(nh2)
P04330 RIIIK [N8A] synthetic construct LOSCCSLALRLCOVOACKRNOCCT(nh2)
P04334 RIIIK [O13A] synthetic construct LOSCCSLNLRLCAVOACKRNOCCT(nh2)
P04336 RIIIK [O15A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04341 RIIIK [O21A] synthetic construct LOSCCSLNLRLCOVOACKRNACCT(nh2)
P04326 RIIIK [O2A] synthetic construct LASCCSLNLRLCOVOACKRNOCCT(nh2)
P04332 RIIIK [R10A] synthetic construct LOSCCSLNLALCOVOACKRNOCCT(nh2)
P04338 RIIIK [R19A] synthetic construct LOSCCSLNLRLCOVOACKANOCCT(nh2)
P04327 RIIIK [S3A] synthetic construct LOACCSLNLRLCOVOACKRNOCCT(nh2)
P04328 RIIIK [S6A] synthetic construct LOSCCALNLRLCOVOACKRNOCCT(nh2)
P04342 RIIIK [T24A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCA(nh2)
P04335 RIIIK [V14A] synthetic construct LOSCCSLNLRLCOAOACKRNOCCT(nh2)
P04238 RIIIKΔ9 synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P03615 Rt20.1 D superfamily Conus rattus DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCVY
HRRRGHGCSC
P03617 Rt20.2 D superfamily Conus rattus DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCIY
HRRRGHGCSC
P01728 RVIA Conus radiatus CKPOGSOCRVSSYNCCSSCKSYNKKCG
P00840 RXIA I1 superfamily Conus radiatus GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS
SFfKI
P02784 RXIA [BTr33>W] synthetic construct GOSFCKADEKOCEYHADCCNCCLSGICAOSTNWILPGCSTS
SFfKI
P00842 RXIB I1 superfamily Conus radiatus GOSFCKANGKOCSYHADCCNCCLSGICKOSTNVILPGCSTS
SFfRI
P02592 RXIC I1 superfamily Conus radiatus GOSFCKADEKOCKYHADCCNCCLGGICKOSTSWIGCSTNVF
lT
P00843 RXID I1 superfamily Conus radiatus GCKKDRKOCSYHADCCNCCLSGICAOSTNWILPGCSTSTFT
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02525 SIVB A superfamily Conus striatus (Striated cone) ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO
(nh2)
P02980 Sm1.1 A superfamily Conus stercusmuscarum GRCCHPACGONYSC(nh2)
P02530 SmIVA A superfamily Conus stercusmuscarum ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK
OKKS(nh2)
P02529 SmIVB A superfamily Conus stercusmuscarum ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK
OKKS(nh2)
P01620 SmVIA O1 superfamily Conus stercusmuscarum DGCSSGGTFCGIROGLCCSEFCFLWCITFID
P03902 Sr1.1 synthetic construct RTCCSROTCRMEYPELCG(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P04445 SrIB [Gla15E] synthetic construct RTCCSROTCRMEYPELCG(nh2)
P01794 SVIA O1 superfamily Conus striatus (Striated cone) CRSSGSOCGVTSICCGRCYRGKCT(nh2)
P02710 SVIE O1 superfamily Conus striatus (Striated cone) DGCSSGGTFCGIHOGLCCSEFCFLWCITFID
P01616 TIIIA M superfamily Conus tulipa (tulip cone) RHGCCKGOKGCSSRECROQHCC(nh2)
P05821 TIIIA[E15A,insC_A] synthetic construct RHGCCKGOKGCSSRACROQHCCA(nh2)
P05822 TIIIA[E15A,insC_AA] synthetic construct RHGCCKGOKGCSSRACROQHCCAA(nh2)
P05826 TIIIA[E15A,insC_AD] synthetic construct RHGCCKGOKGCSSRACROQHCCAD(nh2)
P05825 TIIIA[E15A,insC_AK] synthetic construct RHGCCKGOKGCSSRACROQHCCAK(nh2)
P05824 TIIIA[E15A,insC_D] synthetic construct RHGCCKGOKGCSSRACROQHCCD(nh2)
P05823 TIIIA[E15A,insC_K] synthetic construct RHGCCKGOKGCSSRACROQHCCK(nh2)
P05820 TIIIA[E15A] synthetic construct RHGCCKGOKGCSSRACROQHCC(nh2)
P01727 TVIA Conus tulipa (tulip cone) CLSOGSSCSOTSYNCCRSCNOYSRKC
P01405 TVIIA O1 superfamily Conus tulipa (tulip cone) SCSGRDSRCOOVCCMGLMCSRGKCVSIYGE
P02883 Tx1.2 A superfamily Conus textile (Cloth-of-gold cone) ROQCCSHOACNVDHPEIC
P03755 Tx10b Conus textile (Cloth-of-gold cone) DPCCGYRMCVOC(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P03749 Tx3e Conus textile (Cloth-of-gold cone) SCCNAGFCRFGCTOCCY
P05831 Tx3i Conus textile (Cloth-of-gold cone) CCGOTACLAGCKPCC(nh2)
P05834 Tx3j Conus textile (Cloth-of-gold cone) CCDDSECSTSCWOCCY
P05835 Tx6.5 Conus textile (Cloth-of-gold cone) NCPYCVVYCCPOAYCQASGCRPP
P05832 TxIC T superfamily Conus textile (Cloth-of-gold cone) DKQTCCGYRMCVOC(nh2)
P02562 TxIIIC M superfamily Conus textile (Cloth-of-gold cone) CCRTCFGCTOCC(nh2)
P03212 TxMEKL-P2 O2 superfamily Conus textile (Cloth-of-gold cone) DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF
P03156 TxMMSK-03 M superfamily Conus textile (Cloth-of-gold cone) CCNAGFCRFGCTOCCY
P02556 TxO4 O1 superfamily Conus textile (Cloth-of-gold cone) YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA
P01543 TxVA T superfamily Conus textile (Cloth-of-gold cone) (Gla)CC(Gla)DG(Btr)CC(gTr)AAO
P04466 Vc1.1 [P6O] synthetic construct GCCSDORCNYDHPEIC(nh2)
P09005 Vc1.1[P6(Hyp)] synthetic construct GCCSDORCNYDHPEIC(nh2)
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02540 VcVA T superfamily Conus victoriae CCPGKOCCRI(nh2)
P02649 Vi6.1 O1 superfamily Conus virgo DCGGQGEGCYTQOCCOGLRCRGGGTGGGVCQL
P01686 VxXXA D superfamily Conus vexillum DVQDCQVSTOGSKWGRCCLNRVCGPMCCPASHCYCVYHRGR
GHGCSC