Protein List

Your search: Protein Type in [Wild type] and Sequence evidence in [protein level] and PTM in [Bromotryptophan]

Found 19 entries.


ID Name Gene superfamily Organism Sequence
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(BTr)EPWC(nh2)
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(BTr)C(nh2)
P01811 Bromosleeper peptide O3 superfamily Conus radiatus (BTr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW
QCV(Gla)ACPV
P02550 De13a Conus delessertii DCOTSCOTTCANG(BTr)ECC(hLy)GYOCVN(hLy)ACSG
CTH(nh2)
P01511 Gla(1)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) GM(BTr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla)
GSCTM(BTr)
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(BTr)GCG
CACS(nh2)
P01617 Mo1274 T superfamily Conus monile GN(BTr)CCSARVCC
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(BTr)HPTWCPWC(nh2)
P05459 Mr062 O1 superfamily Conus marmoreus CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC
AT(BTr)LDL
P05455 Mr14.7 O1 superfamily Conus marmoreus CLDGGEICGICFQAAAVGGALFSSAHETTVMSSTPLCAT(BTr)
LDL
P05380 Mr6.16 O2 superfamily Conus marmoreus TTAES(BTr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL
P05376 Mr6.29 O2 superfamily Conus marmoreus ZC(Gla)DV(BTr)MPCTSSHW(Gla)CCSLDCEMYCTQI
P02589 RVIIA O1 superfamily Conus radiatus (BTr)FGH(Gla)(Gla)CTY(BTr)LGPC(Gla)VDDTCC
SASC(Gla)SKFCGL(BTr)
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
(BTr)VDP(nh2)
P02711 TeA31 T superfamily Conus textile (Cloth-of-gold cone) ICCYPNV(BTr)CCD
P03212 TxMEKL-P2 O2 superfamily Conus textile (Cloth-of-gold cone) DCRGYDAOCSSGAPCCD(BTr)(BTr)TCSARTNRCF
P02556 TxO4 O1 superfamily Conus textile (Cloth-of-gold cone) YDCEPPGNFCGMIKIGPOCCSG(BTr)CFFACA
P01543 TxVA T superfamily Conus textile (Cloth-of-gold cone) (Gla)CC(Gla)DG(BTr)CC(gTr)AAO
P02542 VcVC T superfamily Conus victoriae ICCYPN(Gla)(BTr)CCD