Protein List

Your search: PTM in [Bromotryptophan]

Found 23 entries.

ID Name Gene superfamily Organism Sequence
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(Btr)EPWC(nh2)
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(Btr)C(nh2)
P01811 Bromosleeper peptide O3 superfamily Conus radiatus (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW
P04265 Cal6.4c O1 superfamily Conus californicus GC(Btr)LCLGONACCRGSVCHDYCPS
P01372 Contryphan-R O2 superfamily Conus radiatus GCOwEP(Btr)C(nh2)
P02550 De13a Conus delessertii DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVN(hLy)ACSG
P05522 De13b G superfamily Conus delessertii DCOTSCOTTCANG(Btr)ECC(hLy)GYOCVRQHCSGCNH(nh2)
P01511 Gla(1)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla)
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(Btr)GCG
P06822 GVIIJ O1 superfamily Conus geographus (Geography cone) G(Btr)CGDOGATCGKLRLYCCSGFCD(Scc)YTKTCKDKS
P01617 Mo1274 T superfamily Conus monile GN(Btr)CCSARVCC
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2)
P05459 Mr062 O1 superfamily Conus marmoreus CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC
P05455 Mr14.7 O1 superfamily Conus marmoreus CLDGGEICGICFQAAAVGGALFSSAHETTVMSSTPLCAT(Btr)
P05380 Mr6.16 O2 superfamily Conus marmoreus TTAES(Btr)WEGECLGWSNGCTHOSDCCSNYCKGIYCDL
P05376 Mr6.29 O2 superfamily Conus marmoreus ZC(Gla)DV(Btr)MPCTSSHW(Gla)CCSLDCEMYCTQI
P02589 RVIIA O1 superfamily Conus radiatus (Btr)FGH(Gla)(Gla)CTY(Btr)LGPC(Gla)VDDTCC
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
P02711 TeA31 T superfamily Conus textile (Cloth-of-gold cone) ICCYPNV(Btr)CCD
P03212 TxMEKL-P2 O2 superfamily Conus textile (Cloth-of-gold cone) DCRGYDAOCSSGAPCCD(Btr)(Btr)TCSARTNRCF
P02556 TxO4 O1 superfamily Conus textile (Cloth-of-gold cone) YDCEPPGNFCGMIKIGPOCCSG(Btr)CFFACA
P01543 TxVA T superfamily Conus textile (Cloth-of-gold cone) (Gla)CC(Gla)DG(Btr)CC(gTr)AAO
P02542 VcVC T superfamily Conus victoriae ICCYPN(Gla)(Btr)CCD