Protein List

Your search: Protein Type in [Wild type] and Sequence evidence in [protein level] and PTM in [C-term amidation]

Found 175 entries.


ID Name Gene superfamily Organism Sequence
P01630 Am2766 O1 superfamily Conus amadis CKQAGESCDIFSQNCCVGTCAFICIE(nh2)
P02501 AnIA Conus anemone CCSHPACAANNQD(sTy)C(nh2)
P00015 AnIB Conus anemone GGCCSHPACAANNQD(sTy)C(nh2)
P00017 AnIC Conus anemone GGCCSHPACFASNPD(sTy)C(nh2)
P05524 As25a Conus austini CKCOSCNFNDVTENCKCCIFRQO(nh2)
P00404 AuIA A superfamily Conus aulicus GCCSYPPCFATNSDYC(nh2)
P00095 AuIB A superfamily Conus aulicus GCCSYPPCFATNPDC(nh2)
P00407 AuIC A superfamily Conus aulicus GCCSYPPCFATNSGYC(nh2)
P02635 BnIA A superfamily Conus bandanus GCCSHPACSVNNPDIC(nh2)
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(BTr)EPWC(nh2)
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(BTr)C(nh2)
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
HP(nh2)
P04135 Cal14a Divergent M---L-LTVA Conus californicus GCPADCPNTCDSSNKCSPGFP(nh2)
P04140 Cal16a Divergent MRCLSIFVLL Conus californicus ZGCVCNANAKFCCGE(nh2)
P01692 CIIIA Conus catus GRCCEGPNGCSSRWCKDHARCC(nh2)
P01558 CnIA A superfamily Conus consors GRCCHPACGKYYSC(nh2)
P00594 CnIB A superfamily Conus consors CCHPACGKYYSC(nh2)
P04091 CnIG Conus consors CCHPACGKYFKC(nh2)
P02901 CnIH A superfamily Conus consors N
GR
CCHPACGKHFSC(nh2)
P01693 CnIIIA Conus consors GRCCDVPNACSGRWCRDHAQCC(nh2)
P03834 CnIIIC M superfamily Conus consors ZGCCNGPKGCSSKWCRDHARCC(nh2)
P05228 CnIIID Conus consors RCCRWPCPRKIDGEYCGCCL(nh2)
P04090 CnIJ Conus consors GR
CCHPACGGKYFKC(nh2)
P05353 CnIK Conus consors NGRCCHOACGKYYSC(nh2)
P05351 CnIL A superfamily Conus consors DGRCCHPACGKYYSC(nh2)
P05354 CnVA Conus consors ECCHRQLLCCLRFV(nh2)
P01632 CnVIIA O1 superfamily Conus consors CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2)
P05234 CnVIIB O1 superfamily Conus consors CKGKGASCRRTSYDCCTGSCRSGKC(nh2)
P05233 CnVIID O1 superfamily Conus consors CKGKGASCSRTMYNCCSGSCNRGKCG(nh2)
P01338 Conantokin-G B1 superfamily Conus geographus (Geography cone) GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2)
P03535 Conantokin-Pr3 Conus parius GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2)
P01269 Conantokin-T Conus tulipa (tulip cone) GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2)
P02747 conolysin-Mt2 Conus mustelinus FHPSLWVLIPQYIQLIRKILKS(nh2)
P03622 Conomap-Vt Conus vitulinus AfVKGSAQRVAHGY(nh2)
P01267 conopressin-S [Arg] Conus striatus (Striated cone) CIIRNCPRG(nh2)
P03556 Conopressin-T Conus tulipa (tulip cone) CYIQNCLRV(nh2)
P01317 Conorfamide-Sr1 Conus spurius GPMGWVPVFYRF(nh2)
P03538 Conorfamide-Sr2 Conus spurius GPM(Gla)DPL(Gla)IIRI(nh2)
P06810 conorfamide-Vc1 Conus victoriae HSGFLLAWSGPRNRFVR(nh2)
P01270 Contryphan-Am Conus amadis GCOwDPWC(nh2)
P01271 Contryphan-In Conus inscriptus GCVlYPWC(nh2)
P01272 Contryphan-Lo Conus loroisii GCPwDPWC(nh2)
P02570 contryphan-M O2 superfamily Conus marmoreus N(Gla)S(Gla)CPwHPWC(nh2)
P05389 contryphan-M2 O2 superfamily Conus marmoreus ESECPWHPWC(nh2)
P01372 Contryphan-R O2 superfamily Conus radiatus GCOwEPWC(nh2)
P03549 Contryphan-S O2 superfamily Conus striatus (Striated cone) GCOwEPWC(nh2)
P01318 Contryphan-Sm O2 superfamily Conus stercusmuscarum GCOwQPWC(nh2)
P02622 Contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) GCOwQPYC(nh2)
P01309 Contryphan-Vn Conus ventricosus GDCPwKPWC(nh2)
P02548 CVIA O1 superfamily Conus catus CKSTGASCRRTSYDCCTGSCRSGRC(nh2)
P01726 CVIB O1 superfamily Conus catus CKGKGASCRKTMYDCCRGSCRSGRC(nh2)
P01725 CVIC O1 superfamily Conus catus CKGKGQSCSKLMYDCCTGSCSRRGKC(nh2)
P02549 CVID O1 superfamily Conus catus CKSKGAKCSKLMYDCCSGSCSGTVGRC(nh2)
P02550 De13a Conus delessertii DCOTSCOTTCANG(BTr)ECC(hLy)GYOCVN(hLy)ACSG
CTH(nh2)
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P00050 EI A superfamily Conus ermineus (Atlantic fish-hunting cone) RDOCCYHPTCNMSNPQIC(nh2)
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P01635 EIVA Conus ermineus (Atlantic fish-hunting cone) GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2)
P01740 EIVB Conus ermineus (Atlantic fish-hunting cone) GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2)
P00405 EpI A superfamily Conus episcopatus GCCSDPRCNMNNPD(sTy)C(nh2)
P01561 EVIA O1 superfamily Conus ermineus (Atlantic fish-hunting cone) DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2)
P01307 Gamma-conopressin-vil Conus villepinii CLIQDCP(Gla)G(nh2)
P00074 GI A superfamily Conus geographus (Geography cone) ECCNPACGRHYSC(nh2)
P00024 GII A superfamily Conus geographus (Geography cone) ECCHPACGKHFSC(nh2)
P01571 GIIIA M superfamily Conus geographus (Geography cone) RDCCTOOKKCKDRQCKOQRCCA(nh2)
P01566 GIIIB M superfamily Conus geographus (Geography cone) RDCCTOORKCKDRRCKOMKCCA(nh2)
P01744 GIIIC Conus geographus (Geography cone) RDCCTOOKKCKDRRCKOLKCCA(nh2)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02692 Gla-MrIII T superfamily Conus marmoreus FCCRTQ(Gla)VCC(Gla)AIKN(nh2)
P01546 GVIA O1 superfamily Conus geographus (Geography cone) CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2)
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(BTr)GCG
CACS(nh2)
P00010 ImI A superfamily Conus imperialis GCCSDPRCAWRC(nh2)
P06776 LsIA Conus limpusi SGCCSNPACRVNNPNIC(nh2)
P01382 Lys conopressin G Conus imperialis CFIRNCPKG(nh2)
P01266 Lys-conopressin G Conus geographus (Geography cone) CFIRNCPKG(nh2)
P02676 MaI51 O2 superfamily Conus marmoreus QCEDVWMPCTSNWECCSLDCEMYCTQI(nh2)
P00023 MI A superfamily Conus magus (Magus cone) GRCCHPACGKNYSC(nh2)
P05865 MIC Conus magus (Magus cone) CCHPACGKNYSC(nh2)
P00039 MII A superfamily Conus magus (Magus cone) GCCSNPVCHLEHSNLC(nh2)
P01691 MIIIA Conus magus (Magus cone) ZGCCNVPNGCSGRWCRDHAQCC(nh2)
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
COOKRKO(nh2)
P05409 Mr026 I2 superfamily Conus marmoreus LCDSYISSELCEHPEETCLLPQSYVLSVESIQTGSVYVLGS
VPHISKTS(nh2)
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(BTr)HPTWCPWC(nh2)
P02491 Mr1.1 A superfamily Conus marmoreus GCCSHPACSVNNPDIC(nh2)
P06002 Mr1.8a A superfamily Conus marmoreus ECCTHPACHVSNPELC(nh2)
P05431 Mr1.9 M superfamily Conus marmoreus VCCPFGGCHELCTADD(nh2)
P05411 Mr14.6 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE
SIQTGSVYVLEACRIFTKTS(nh2)
P05416 Mr3.11 M superfamily Conus marmoreus CCRIACNLKCNOCC(nh2)
P05422 Mr3.12 M superfamily Conus marmoreus LCCWKEWCHARCTCC(nh2)
P05424 Mr3.13 M superfamily Conus marmoreus LCCWIHWCHARCTCC(nh2)
P05433 Mr3.16 M superfamily Conus marmoreus VCCSFGSCDSLCQCCD(nh2)
P05378 Mr6.12 O2 superfamily Conus marmoreus GCKATWMSCSSGWECCSMSCDMYC(nh2)
P05373 Mr6.28 O2 superfamily Conus marmoreus QCEDVWMPCTSNWECCSLDCERYCTQI(nh2)
P02696 MrIIID M superfamily Conus marmoreus CCRLSCGLGCHOCC(nh2)
P02697 MrIIIE M superfamily Conus marmoreus VCCPFGGCHELCYCCD(nh2)
P01485 MrIIIF M superfamily Conus marmoreus VCCPFGGCHELCLCCD(nh2)
P02698 MrIIIG M superfamily Conus marmoreus DCCOLPACPFGCNOCC(nh2)
P01386 MVIIA O1 superfamily Conus magus (Magus cone) CKGKGAKCSRLMYDCCTGSCRSGKC(nh2)
P01638 MVIIB O1 superfamily Conus magus (Magus cone) CKGKGASCHRTSYDCCTGSCNRGKC(nh2)
P01397 OIVA A superfamily Conus obscurus CCGVONAACHOCVCKNTC(nh2)
P01688 OIVB A superfamily Conus obscurus CCGVONAACPOCVCNKTCG(nh2)
P00006 OmIA A superfamily Conus omaria GCCSHPACNVNNPHICG(nh2)
P05219 Pc16a Conus pictus SCSCKRNFLCC(nh2)
P05862 Pc16c Conus pictus SCSCQKHFSCCD(nh2)
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P01611 PIIIE M superfamily Conus purpurascens HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P01594 PIIIF M superfamily Conus purpurascens GOOCCLYGSCROFOGCYNALCCRK(nh2)
P01449 PIVA A superfamily Conus purpurascens GCCGSYONAACHOCSCKDROSYCGQ(nh2)
P01670 PIVE Conus purpurascens DCCGVKLEMCHPCLCDNSCKNYGK(nh2)
P01669 PIVF Conus purpurascens DCCGVKLEMCHPCLCDNSCKKSGK(nh2)
P01539 PlXIVA J superfamily Conus planorbis FPRPRICNLACRAGIGHKYPFCHCR(nh2)
P00051 PnIA A superfamily Conus pennaceus GCCSLPPCAANNPD(sTy)C(nh2)
P00099 PnIB A superfamily Conus pennaceus GCCSLPPCALSNPD(sTy)C(nh2)
P02859 PrXA Conus parius TYGIYDAKPOFSCAGLRGGCVLPONLROKFKE(nh2)
P02596 PVA T superfamily Conus purpurascens GCCPKQMRCCTL(nh2)
P02595 PVIA O1 superfamily Conus purpurascens EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2)
P01356 PVIIA O1 superfamily Conus purpurascens CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P01493 Reg12e M superfamily Conus regius KCCMRPICTCOCCIGP(nh2)
P00028 Reg1b/Reg1c A superfamily Conus regius GCCSDORCKHQC(nh2)
P00029 Reg1d A superfamily Conus regius GCCSDPRCKHEC(nh2)
P00030 Reg1e A superfamily Conus regius GCCSDORCRYRC(nh2)
P00031 Reg1f A superfamily Conus regius DYCCRROOCTLIC(nh2)
P00032 RegIIA A superfamily Conus regius GCCSHPACNVNNPHIC(nh2)
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
(BTr)VDP(nh2)
P00001 SI A superfamily Conus striatus (Striated cone) ICCNPACGPKYSC(nh2)
P00025 SIA A superfamily Conus striatus (Striated cone) YCCHPACGKNFDC(nh2)
P02707 SIIIA M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCRDHARCC(nh2)
P01615 SIIIB M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCKGHARCC(nh2)
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02980 Sm1.1 A superfamily Conus stercusmuscarum GRCCHPACGONYSC(nh2)
P02903 Sm1.3 A superfamily Conus stercusmuscarum GCCSNPVCHLEHSN(Mox)C(nh2)
P05838 Sm1.4 Conus stercusmuscarum I(Mox)YDCCSGSCSGYTGRC(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P01450 SrVIIA O1 superfamily Conus spurius CLQFGSTCFLGDDDICCSGECFYSGGTFGICS(nh2)
P02802 SrXIA I2 superfamily Conus spurius CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2)
P01794 SVIA O1 superfamily Conus striatus (Striated cone) CRSSGSOCGVTSICCGRCYRGKCT(nh2)
P01793 SVIB O1 superfamily Conus striatus (Striated cone) CKLKGQSCRKTSYDCCSGSCGRSGKC(nh2)
P02568 TeAr151 T superfamily Conus textile (Cloth-of-gold cone) VCCRPMQDCCS(nh2)
P01634 TIA A superfamily Conus tulipa (tulip cone) FNWRCCLIPACRRNHKKFC(nh2)
P03755 Tx10b Conus textile (Cloth-of-gold cone) DPCCGYRMCVOC(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P03753 Tx1c Conus textile (Cloth-of-gold cone) GCCSRPPCIANNPDIC(nh2)
P02560 Tx3a M superfamily Conus textile (Cloth-of-gold cone) CCSWDVCDHPSCTCCG(nh2)
P02564 Tx3f M superfamily Conus textile (Cloth-of-gold cone) RCCKFPCPDSCRYLCC(nh2)
P02565 Tx3h M superfamily Conus textile (Cloth-of-gold cone) KFCCDSNWCHISDCECCY(nh2)
P05831 Tx3i Conus textile (Cloth-of-gold cone) CCGOTACLAGCKPCC(nh2)
P02561 Tx5.1 T superfamily Conus textile (Cloth-of-gold cone) CCQTFYWCCVQ(nh2)
P05827 Tx5.2 Conus textile (Cloth-of-gold cone) CCPPVIWCC(nh2)
P05828 Tx5.3 Conus textile (Cloth-of-gold cone) QTCCGSKVFCC(nh2)
P05833 Tx5.5 Conus textile (Cloth-of-gold cone) NIQIICCKHTPKCCT(nh2)
P03756 Tx5c Conus textile (Cloth-of-gold cone) KPCCSIHDNSCCGI(nh2)
P03758 Tx5d Conus textile (Cloth-of-gold cone) NIQIICCKHTPACCT(nh2)
P05864 Tx5e Conus textile (Cloth-of-gold cone) PCCSKLHDNSCCGL(nh2)
P05837 Tx6.6 O1 superfamily Conus textile (Cloth-of-gold cone) DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA(nh2)
P02881 TxIA A superfamily Conus textile (Cloth-of-gold cone) GCCSROOCIANNPDLC(nh2)
P05832 TxIC T superfamily Conus textile (Cloth-of-gold cone) DKQTCCGYRMCVOC(nh2)
P06831 TxID Conus textile (Cloth-of-gold cone) GCCSHPVCSAMSPIC(nh2)
P02563 TxIIIB M superfamily Conus textile (Cloth-of-gold cone) CCPPVACNMGCKPCC(nh2)
P02562 TxIIIC M superfamily Conus textile (Cloth-of-gold cone) CCRTCFGCTOCC(nh2)
P02559 TxIXA P superfamily Conus textile (Cloth-of-gold cone) GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2)
P03170 TxMLKM-021 M superfamily Conus textile (Cloth-of-gold cone) VCCPFGGCHELCQCCE(nh2)
P01517 TxVIIA O2 superfamily Conus textile (Cloth-of-gold cone) CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2)
P02551 TxX I2 superfamily Conus textile (Cloth-of-gold cone) SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS
THTCCHWARRDQCMKPQRCISAQKGN(nh2)
P02552 TxXI I2 superfamily Conus textile (Cloth-of-gold cone) CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2)
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02540 VcVA T superfamily Conus victoriae CCPGKOCCRI(nh2)
P02541 VcVB T superfamily Conus victoriae CCQTFYWCCGQ(nh2)
P02788 Vi1361 Conus virgo ZCCPTMPECCRI(nh2)
P01672 ViVA T superfamily Conus virgo ZCCITIPECCRI(nh2)
P01671 ViVB T superfamily Conus virgo ZCCPTIPECCRV(nh2)
P02836 ViXVA V superfamily Conus virgo DCTTCAGEECCGRCTCPWGDNCSCIEW(nh2)
P01390 Vn6A Conus ventricosus EDCIAVGQLCVFWNIGRPCCSGLCVFACTVKLP(nh2)
P04985 Vr3-T05 M superfamily Conus varius EIILHALGTRCCSWDVCDHPSCTCC(nh2)