Protein List

Your search: PTM in [C-term amidation]

Found 669 entries.

ID Name Gene superfamily Organism Sequence
P04258 Ac-AuIB synthetic construct (Ac)GCCSYPPCFATNPDC(nh2)
P04404 Ac-ImI synthetic construct (Ac)GCCSDPRCAWRC(nh2)
P04343 Ac-L1 synthetic construct (Ac)LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P03833 Ac1.1a A superfamily Conus achatinus NGRCCHPACGKHFNC(nh2)
P02485 Ac1.1b A superfamily Conus achatinus NGRCCHPACGKHFSC(nh2)
P04393 Ac1.1b [Del1] synthetic construct GRCCHPACGKHFSC(nh2)
P02487 Ac4.2 A superfamily Conus achatinus APWMVVTATTNCCGYTGPACHPCLCTQSC(nh2)
P02489 Ac4.3a A superfamily Conus achatinus QKELVVTATTTCCGYNPMTSCPRCMCDSSCNKKKK(nh2)
P02490 Ac4.3b A superfamily Conus achatinus QKELVPSKITTCCGYSPGTACPSCMCTNTCKKKNKKP(nh2)
P01630 Am2766 O1 superfamily Conus amadis CKQAGESCDIFSQNCCVGTCAFICIE(nh2)
P02501 AnIA Conus anemone CCSHPACAANNQD(sTy)C(nh2)
P00015 AnIB Conus anemone GGCCSHPACAANNQD(sTy)C(nh2)
P04396 AnIB [Del1] synthetic construct GCCSHPACAANNQD(sTy)C(nh2)
P04394 AnIB [sTy16Y] synthetic construct GGCCSHPACAANNQDYC(nh2)
P00017 AnIC Conus anemone GGCCSHPACFASNPD(sTy)C(nh2)
P04232 Ar1446 Conus araneosus CCRLACGLGCHOCC(nh2)
P05524 As25a Conus austini CKCOSCNFNDVTENCKCCIFRQO(nh2)
P00404 AuIA A superfamily Conus aulicus GCCSYPPCFATNSDYC(nh2)
P00095 AuIB A superfamily Conus aulicus GCCSYPPCFATNPDC(nh2)
P04480 AuIB [ribbon isoform] synthetic construct GCCSYPPCFATNPDC(nh2)
P00407 AuIC A superfamily Conus aulicus GCCSYPPCFATNSGYC(nh2)
P02531 Bn1.2 Conus bandanus ECCTHPACHVSHPELC(nh2)
P02483 Bn1.3 A superfamily Conus bandanus DYCCHRGPCMVWC(nh2)
P02635 BnIA A superfamily Conus bandanus GCCSHPACSVNNPDIC(nh2)
P03551 Bromocontryphan-S Conus striatus (Striated cone) GCO(BTr)EPWC(nh2)
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(BTr)C(nh2)
P07501 Bt1.8 Conus betulinus GCCSNPACILNNPNQC(nh2)
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
P04599 Bu10 Conus bullatus CKLSGYRCKRPKQCCNLSCGNYMC(nh2)
P04597 Bu17 Conus bullatus GLYCCQPKPNGQMMCNRWCEINSRCC(nh2)
P04575 Bu19 A superfamily Conus bullatus GCCHDIFCKHNNPDIC(nh2)
P04582 Bu23 A superfamily Conus bullatus LNDLVPQYWTECCGRIGPHCSRCICPEVVCPKN(nh2)
P04584 Bu24 A superfamily Conus bullatus YWTECCGRIGPHCSRCICPEVACPKN(nh2)
P04586 Bu25 A superfamily Conus bullatus YWTECCGRIGPHCSRCICPGVVCPKR(nh2)
P04616 Bu5 O1 superfamily Conus bullatus SCTDDFEPCEAGFENCCSKSCFEFEDVYVC(nh2)
P04618 Bu6 O1 superfamily Conus bullatus DSCVPDGDSCLFSRIPCCGTCSSRSKSCV(nh2)
P04622 Bu8 Conus bullatus CKRKGSSCRRTSYDCCTGSCRNGKC(nh2)
P00026 BuIA A superfamily Conus bullatus GCCSTPPCAVLYC(nh2)
P05871 BuIA[A9S] synthetic construct GCCSTPPCSVLYC(nh2)
P05873 BuIA[L11A] synthetic construct GCCSTPPCAVAYC(nh2)
P05869 BuIA[P6O] synthetic construct GCCSTOPCAVLYC(nh2)
P05870 BuIA[P7O] synthetic construct GCCSTPOCAVLYC(nh2)
P05867 BuIA[S4A] synthetic construct GCCATPPCAVLYC(nh2)
P05868 BuIA[T5A] synthetic construct GCCSAPPCAVLYC(nh2)
P05872 BuIA[V10A] synthetic construct GCCSTPPCAALYC(nh2)
P05874 BuIA[Y12A] synthetic construct GCCSTPPCAVLAC(nh2)
P03623 BuIIIA M superfamily Conus bullatus VTDRCCKGKRECGRWCRDHSRCC(nh2)
P05364 BuIIIA[Del1-4] synthetic construct CCKNGKRGCGRWCRDHSRCC(nh2)
P03625 BuIIIB M superfamily Conus bullatus VGERCCKNGKRGCGRWCRDHSRCC(nh2)
P05362 BuIIIB[E3A] synthetic construct VGARCCKNGKRGCGRWCRDHSRCC(nh2)
P05361 BuIIIB[G2A] synthetic construct VAERCCKNGKRGCGRWCRDHSRCC(nh2)
P05359 BuIIIB[G2dAla] synthetic construct VaERCCKNGKRGCGRWCRDHSRCC(nh2)
P05363 BuIIIB[R4A] synthetic construct VGEACCKNGKRGCGRWCRDHSRCC(nh2)
P05360 BuIIIB[V1A] synthetic construct AGERCCKNGKRGCGRWCRDHSRCC(nh2)
P03628 BuIIIC M superfamily Conus bullatus IVDRCCNKGNGKRGCSRWCRDHSRCC(nh2)
P04133 Cal14.1b Divergent MKLCVVIVLL Conus californicus GIWCDPPCPEGETCRGGECSDEFNGDM(nh2)
P04134 Cal14.1c Divergent MKLCVVIVLL Conus californicus GIWCDPPCPEGETCRGGECSDEFNGDL(nh2)
P04135 Cal14a Divergent M---L-LTVA Conus californicus GCPADCPNTCDSSNKCSPGFP(nh2)
P04140 Cal16a Divergent MRCLSIFVLL Conus californicus ZGCVCNANAKFCCGE(nh2)
P04917 Cltx-4 Conus californicus ROKCCCVCGVVGRKCCSTWDKCHOVHLOCOSS(nh2)
P02855 CMrVIA [K6P] amidated synthetic construct VCCGYPLCHOC(nh2)
P02856 CMrVIA amidated synthetic construct VCCGYKLCHOC(nh2)
P01558 CnIA A superfamily Conus consors GRCCHPACGKYYSC(nh2)
P00594 CnIB A superfamily Conus consors CCHPACGKYYSC(nh2)
P04091 CnIG Conus consors CCHPACGKYFKC(nh2)
P02901 CnIH A superfamily Conus consors N
P03834 CnIIIC M superfamily Conus consors ZGCCNGPKGCSSKWCRDHARCC(nh2)
P04090 CnIJ Conus consors GR
P05353 CnIK Conus consors NGRCCHOACGKYYSC(nh2)
P05351 CnIL A superfamily Conus consors DGRCCHPACGKYYSC(nh2)
P05354 CnVA Conus consors ECCHRQLLCCLRFV(nh2)
P01632 CnVIIA O1 superfamily Conus consors CKGKGAOCTRL(Mox)YDCCHGSCSSSKGRC(nh2)
P05234 CnVIIB O1 superfamily Conus consors CKGKGASCRRTSYDCCTGSCRSGKC(nh2)
P05232 CnVIIC O1 superfamily Conus consors CKGTGKOCSRIAYNCCTGSCRSGKC(nh2)
P05233 CnVIID O1 superfamily Conus consors CKGKGASCSRTMYNCCSGSCNRGKCG(nh2)
P07401 Con-BkB Conus sulcatus GE(Gla)(Gla)YS(Gla)AI(nh2)
P04643 Conantokin-Eu2 Conus eburneus GQEERAEASYEKLLEI(nh2)
P01338 Conantokin-G B1 superfamily Conus geographus (Geography cone) GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2)
P05725 Conantokin-G2 B1 superfamily Conus geographus (Geography cone) GEEEVQENQELIREASN(nh2)
P05699 Conantokin-G[+10Gla,Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Gla)(Buc)LIR(Buc)KS
P07643 conantokin-G[+10O] synthetic construct GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2)
P05698 Conantokin-G[Gla10Bsc,Gla14Bsc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Bsc)LIR(Bsc)KSN(nh2)
P05697 Conantokin-G[Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Buc)LIR(Buc)KSN(nh2)
P05700 Conantokin-G[Gla7Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Huc)NQ(Gla)LIR(Buc)KSN(nh2)
P02637 Conantokin-L B1 superfamily Conus lynceus GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)DAVN(nh2)
P04501 Conantokin-L2.2 B1 superfamily Conus litteratus GPEEDSETTVEELHEI(nh2)
P03535 Conantokin-Pr3 Conus parius GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2)
P05841 Conantokin-Rl2 B1 superfamily Conus rolani GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05846 conantokin-Rl2[delO10] synthetic construct GE(Gla)(Gla)LA(Gla)KA(Gla)FAR(Gla)LAN(nh2)
P05848 Conantokin-Rl2[K8N,A9Q,del10O] synthetic construct GE(Gla)(Gla)LA(Gla)NQ(Gla)FAR(Gla)LAN(nh2)
P05847 Conantokin-Rl2[K8Nle] synthetic construct GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA
P05844 Conantokin-Rl2[L5Y] synthetic construct GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05845 conantokin-Rl2[O10A] synthetic construct GE(Gla)(Gla)LA(Gla)KAA(Gla)FAR(Gla)LAN(nh2)
P07642 conantokin-Rl2[O10P] synthetic construct GE(Gla)(Gla)LA(Gla)KAP(Gla)FAR(Gla)LAN(nh2)
P05851 Conantokin-Rl3 B1 superfamily Conus rolani GE(Gla)(Gla)LS(Gla)NAV(Gla)FAR(Gla)LAN(nh2)
P01269 Conantokin-T Conus tulipa (tulip cone) GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2)
P02747 conolysin-Mt2 Conus mustelinus FHPSLWVLIPQYIQLIRKILKS(nh2)
P03622 Conomap-Vt Conus vitulinus AfVKGSAQRVAHGY(nh2)
P06673 conomarphin-Vc2 M superfamily Conus victoriae GWHYHPYQNPKPT(nh2)
P05544 conopressin-Cn Conus consors CYIRDCPE(nh2)
P01267 conopressin-S [Arg] Conus striatus (Striated cone) CIIRNCPRG(nh2)
P03556 Conopressin-T Conus tulipa (tulip cone) CYIQNCLRV(nh2)
P01317 Conorfamide-Sr1 Conus spurius GPMGWVPVFYRF(nh2)
P03538 Conorfamide-Sr2 Conus spurius GPM(Gla)DPL(Gla)IIRI(nh2)
P06810 conorfamide-Vc1 Conus victoriae HSGFLLAWSGPRNRFVR(nh2)
P01270 Contryphan-Am Conus amadis GCOwDPWC(nh2)
P04624 Contryphan-Bu O2 superfamily Conus bullatus KCOwSPWC(nh2)
P01271 Contryphan-In Conus inscriptus GCVlYPWC(nh2)
P01272 Contryphan-Lo Conus loroisii GCPwDPWC(nh2)
P02621 contryphan-Lt O2 superfamily Conus litteratus GCOwEPWC(nh2)
P02570 contryphan-M O2 superfamily Conus marmoreus N(Gla)S(Gla)CPwHPWC(nh2)
P05389 contryphan-M2 O2 superfamily Conus marmoreus ESECPWHPWC(nh2)
P02597 Contryphan-P O2 superfamily Conus purpurascens GCOwDPWC(nh2)
P01372 Contryphan-R O2 superfamily Conus radiatus GCOwEPWC(nh2)
P01355 Contryphan-R [Des-Gly1] synthetic construct COwQPWC(nh2)
P03549 Contryphan-S O2 superfamily Conus striatus (Striated cone) GCOwEPWC(nh2)
P01318 Contryphan-Sm O2 superfamily Conus stercusmuscarum GCOwQPWC(nh2)
P02622 Contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) GCOwQPYC(nh2)
P04517 Contryphan-Vi O2 superfamily Conus virgo GCPWHPWC(nh2)
P01309 Contryphan-Vn Conus ventricosus GDCPwKPWC(nh2)
P02548 CVIA O1 superfamily Conus catus CKSTGASCRRTSYDCCTGSCRSGRC(nh2)
P01726 CVIB O1 superfamily Conus catus CKGKGASCRKTMYDCCRGSCRSGRC(nh2)
P01725 CVIC O1 superfamily Conus catus CKGKGQSCSKLMYDCCTGSCSRRGKC(nh2)
P02549 CVID O1 superfamily Conus catus CKSKGAKCSKLMYDCCSGSCSGTVGRC(nh2)
P04324 CVID[K10R] synthetic construct CKSKGAKCSRLMYDCCSGSCSGTVGRC(nh2)
P05863 CVID[K2A,K10R] synthetic construct CASKGAKCSRLMYDCCSGSCSGTVGRC(nh2)
P04243 CVIE-2 O1 superfamily Conus catus CKGKGASCRRTSYDCCTGSCRSGRC(nh2)
P01262 Cyclic contryphan synthetic construct GCOyNPKC(nh2)
P02550 De13a Conus delessertii DCOTSCOTTCANG(BTr)ECC(hLy)GYOCVN(hLy)ACSG
P05522 De13b G superfamily Conus delessertii DCOTSCOTTCANG(BTr)ECC(hLy)GYOCVRQHCSGCNH(nh2)
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P00050 EI A superfamily Conus ermineus (Atlantic fish-hunting cone) RDOCCYHPTCNMSNPQIC(nh2)
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P01635 EIVA Conus ermineus (Atlantic fish-hunting cone) GCCGPYONAACHOCGCKVGROOYCDROSGG(nh2)
P01740 EIVB Conus ermineus (Atlantic fish-hunting cone) GCCGKYONAACHOCGCTVGROOYCDROSGG(nh2)
P02569 Em11.10 I2 superfamily Conus emaciatus CFPPGIYCTPYLPCCWGICCGTCRNVCHLRI(nh2)
P02577 Ep11.12 I2 superfamily Conus episcopatus CLSEGSPCSMSGSCCHKSCCRSTCTFPCLIP(nh2)
P00405 EpI A superfamily Conus episcopatus GCCSDPRCNMNNPD(sTy)C(nh2)
P00112 EpI [sTy15>Y] synthetic construct GCCSDPRCNMNNPDYC(nh2)
P04507 Eu1.3 A superfamily Conus eburneus LIAPFIRDYCCPRGPCMVWC(nh2)
P01561 EVIA O1 superfamily Conus ermineus (Atlantic fish-hunting cone) DDCIKOYGFCSLPILKNGLCCSGACVGVCADL(nh2)
P01575 EVIB O1 superfamily Conus ermineus (Atlantic fish-hunting cone) EACYOOGTFCGIKOGLCCSELCLPAVCVG(nh2)
P02719 Fe14.1 J superfamily Conus ferrugineus SPGSTICKMACRTGNGHKYPFCNCR(nh2)
P02720 Fe14.2 J superfamily Conus ferrugineus SSGSTVCKMMCRLGYGHLYPSCGCR(nh2)
P02656 Fi11.11 I2 superfamily Conus figulinus CHHEGLPCTSGDGCCGMECCGGVCSSHCGN(nh2)
P01307 Gamma-conopressin-vil Conus villepinii CLIQDCP(Gla)G(nh2)
P00074 GI A superfamily Conus geographus (Geography cone) ECCNPACGRHYSC(nh2)
P04398 GI [R9A] synthetic construct ECCNPACGAHYSC(nh2)
P00408 GI antitoxic analog synthetic construct CANPACGRHYS(nh2)
P00132 GIC A superfamily Conus geographus (Geography cone) GCCSHPACAGNNQHIC(nh2)
P03557 GID*-NH2 synthetic construct IRDECCSNPACRVNNOHVC(nh2)
P00024 GII A superfamily Conus geographus (Geography cone) ECCHPACGKHFSC(nh2)
P01571 GIIIA M superfamily Conus geographus (Geography cone) RDCCTOOKKCKDRQCKOQRCCA(nh2)
P01570 GIIIA [R13A] synthetic construct RDCCTOOKKCKDAQCKOQRCCA(nh2)
P01566 GIIIB M superfamily Conus geographus (Geography cone) RDCCTOORKCKDRRCKOMKCCA(nh2)
P01744 GIIIC Conus geographus (Geography cone) RDCCTOOKKCKDRRCKOLKCCA(nh2)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02692 Gla-MrIII T superfamily Conus marmoreus FCCRTQ(Gla)VCC(Gla)AIKN(nh2)
P04397 Gly-AnIB synthetic construct GGGCCSHPACAANNQD(sTy)C(nh2)
P02574 Gm5.2 T superfamily Conus gloriamaris VCCRPVQDCCS(nh2)
P02576 GmIXA P superfamily Conus gloriamaris SCNNSCQSHSDCASHCICTFRGCGAVN(nh2)
P01546 GVIA O1 superfamily Conus geographus (Geography cone) CKSOGSSCSOTSYNCCRSCNOYTKRCY(nh2)
P01780 GVIA [O10>K] synthetic construct CKSOGSSCSKTSYNCCRSCNOYTKRCY(nh2)
P05701 GVIA[C8U,C19U] synthetic construct CKSOGSSUSOTSYNCCRSUNOYTKRCY(nh2)
P02582 GVIIIA S superfamily Conus geographus (Geography cone) GCTRTCGGOKCTGTCTCTNSSKCGCRYNVHPSG(BTr)GCG
P04646 Im1.8 A superfamily Conus imperialis LIAPFIRDYCCPRGPCMVWC(nh2)
P02584 Im5.1 T superfamily Conus imperialis SCCGKNPGCCPW(nh2)
P00010 ImI A superfamily Conus imperialis GCCSDPRCAWRC(nh2)
P04412 ImI [A9S] synthetic construct GCCSDPRCAWRC(nh2)
P03636 ImI [C2Agl,C8Agl] synthetic construct G(Agl)CSDPR(Agl)AWRC(nh2)
P02479 ImI [C2U,C3U,C8U,C12U] synthetic construct GUUSDPRUAWRU(nh2)
P02478 ImI [C2U,C8U] synthetic construct GUCSDPRUAWRC(nh2)
P04417 ImI [C3U,C12U] synthetic construct GCUSDPRCAWRU(nh2)
P04469 ImI [D5A] synthetic construct GCCSAPRCAWRC(nh2)
P04405 ImI [D5E] synthetic construct GCCSEPRCAWRC(nh2)
P04406 ImI [D5K] synthetic construct GCCSKPRCAWRC(nh2)
P00035 ImI [D5N] synthetic construct GCCSNPRCAWRC(nh2)
P04416 ImI [D5R,R7D] synthetic construct GCCSRPDCAWRC(nh2)
P04468 ImI [G1A] synthetic construct ACCSDPRCAWRC(nh2)
P04418 ImI [P60] synthetic construct GCCSDORCAWRC(nh2)
P04420 ImI [P6A(S)Pro] synthetic construct GCCSD(A(S)Pro)RCAWRC(nh2)
P02852 ImI [P6A] synthetic construct GCCSDARCAWRC(nh2)
P04419 ImI [P6APro] synthetic construct GCCSD(APro)RCAWRC(nh2)
P04427 ImI [P6benzPro] synthetic construct GCCSD(benz-Pro)RCAWRC(nh2)
P04422 ImI [P6betPro] synthetic construct GCCSD(bet-Pro)RCAWRC(nh2)
P04424 ImI [P6fluo(S)Pro] synthetic construct GCCSD(F-(S)-Pro)RCAWRC(nh2)
P04423 ImI [P6fluoPro] synthetic construct GCCSD(F-Pro)RCAWRC(nh2)
P04407 ImI [P6G] synthetic construct GCCSDGRCAWRC(nh2)
P04421 ImI [P6guaPro] synthetic construct GCCSD(Gua-Pro)RCAWRC(nh2)
P02851 ImI [P6K] synthetic construct GCCSDKRCAWRC(nh2)
P04428 ImI [P6naphPro] synthetic construct GCCSD(naph-Prot)RCAWRC(nh2)
P04429 ImI [P6phi(3S)Pro] synthetic construct GCCSD(phi3-Pro)RCAWRC(nh2)
P04430 ImI [P6phi(5R)Pro] synthetic construct GCCSD(phi5-Pro)RCAWRC(nh2)
P04426 ImI [P6phi(S)Pro] synthetic construct GCCSD(phi-(S)-Pro)RCAWRC(nh2)
P04425 ImI [P6phiPro] synthetic construct GCCSD(phi-Pro)RCAWRC(nh2)
P04473 ImI [P6S] synthetic construct GCCSDSRCAWRC(nh2)
P04408 ImI [P6V] synthetic construct GCCSDVRCAWRC(nh2)
P04472 ImI [R11A] synthetic construct GCCSDPRCAWAC(nh2)
P00033 ImI [R11E] synthetic construct GCCSDPRCAWEC(nh2)
P04415 ImI [R11Q] synthetic construct GCCSDPRCAWQC(nh2)
P04470 ImI [R7A] synthetic construct GCCSDPACAWRC(nh2)
P04411 ImI [R7E] synthetic construct GCCSDPECAWRC(nh2)
P04410 ImI [R7K] synthetic construct GCCSDPKCAWRC(nh2)
P00034 ImI [R7L] synthetic construct GCCSDPLCAWRC(nh2)
P04475 ImI [R7Nle] synthetic construct GCCSDP(Nle)CAWRC(nh2)
P04409 ImI [R7Q] synthetic construct GCCSDPQCAWRC(nh2)
P04403 ImI [S4A] synthetic construct GCCADPRCAWRC(nh2)
P04471 ImI [W10A] synthetic construct GCCSDPRCAARC(nh2)
P04413 ImI [W10F] synthetic construct GCCSDPRCAFRC(nh2)
P04414 ImI [W10T] synthetic construct GCCSDPRCATRC(nh2)
P04474 ImI [W10Y] synthetic construct GCCSDPRCAYRC(nh2)
P06677 Imi1 synthetic construct G(L-Dtn)ASDPRCAWRC(nh2)
P02586 ImII A superfamily Conus imperialis ACCSDRRCRWRC(nh2)
P03894 ImII [W10Y] synthetic construct ACCSDRRCRYRC(nh2)
P03893 ImII-iso synthetic construct ACCSDRRCRWRC(nh2)
P02617 ImIIA A superfamily Conus imperialis YCCHRGPCMVWC(nh2)
P04488 KIIA [W8dTrp] synthetic construct CCNCSSKwCRDHSRCC(nh2)
P02587 KIIIA M superfamily Conus kinoshitai CCNCSSKWCRDHSRCC(nh2)
P04490 KIIIA [D11A] synthetic construct CCNCSSKWCRAHSRCC(nh2)
P04309 KIIIA [H12A] synthetic construct CCNCSSKWCRDASRCC(nh2)
P04307 KIIIA [K7A] synthetic construct CCNCSSAWCRDHSRCC(nh2)
P04485 KIIIA [K7NLeu] synthetic construct CCNCSS(Nle)WCRDHSRCC(nh2)
P04482 KIIIA [N3A] synthetic construct CCACSSKWCRDHSRCC(nh2)
P04489 KIIIA [R10A] synthetic construct CCNCSSKWCADHSRCC(nh2)
P04308 KIIIA [R10A] synthetic construct CCNCSSKWCADHSRCC(nh2)
P04306 KIIIA [R14A] synthetic construct CCNCSSKWCRDHSACC(nh2)
P04491 KIIIA [S13A] synthetic construct CCNCSSKWCRDHARCC(nh2)
P04483 KIIIA [S5A] synthetic construct CCNCASKWCRDHSRCC(nh2)
P04484 KIIIA [S6A] synthetic construct CCNCSAKWCRDHSRCC(nh2)
P04486 KIIIA [W8A] synthetic construct CCNCSSKACRDHSRCC(nh2)
P04323 KIIIA [W8E] synthetic construct CCNCSSKECRDHSRCC(nh2)
P04487 KIIIA [W8L] synthetic construct CCNCSSKLCRDHSRCC(nh2)
P04322 KIIIA [W8Q] synthetic construct CCNCSSKQCRDHSRCC(nh2)
P04321 KIIIA [W8R] synthetic construct CCNCSSKRCRDHSRCC(nh2)
P03578 KIIIA[C1A,C9A] synthetic construct ACNCSSKWARDHSRCC(nh2)
P03579 KIIIA[C2A,C15A] synthetic construct CANCSSKWCRDHSRAC(nh2)
P03580 KIIIA[C4A,C16A] synthetic construct CCNASSKWCRDHSRCA(nh2)
P03581 KIIIA[Del1,S3/S4Aop,C9A] synthetic construct CNC(Aop)KWARDHARCC(nh2)
P02632 LeDr192 T superfamily Conus litteratus ECCEDGWCCTAAPLT(nh2)
P02633 LeDr243 T superfamily Conus litteratus PCCSIHDNSCC(nh2)
P02659 Leu-contryphan-Tx O2 superfamily Conus textile (Cloth-of-gold cone) CVlYPWC(nh2)
P05283 Li1.12 Conus lividus GCCSHPVCSAMSPIC(nh2)
P02578 LiC32 T superfamily Conus lividus LWQNTWCCRDHLRCC(nh2)
P02579 LiC33 T superfamily Conus lividus ALCCYGYRFCCPIF(nh2)
P02496 Lp1.1 A superfamily Conus leopardus GCCARAACAGIHQELC(nh2)
P02505 Lp1.10 A superfamily Conus leopardus NDCCHNAPCRNNHPGIC(nh2)
P02660 Lp1.2 A superfamily Conus leopardus GCCSHPACSVNNPYFCG(nh2)
P02497 Lp1.4 A superfamily Conus leopardus GCCSHPACSGNHQELCD(nh2)
P02498 Lp1.5 A superfamily Conus leopardus DCCDDPACTVNNPGLCT(nh2)
P02499 Lp1.6a A superfamily Conus leopardus QFCCGHYDCDFIPNVC(nh2)
P06776 LsIA Conus limpusi SGCCSNPACRVNNPNIC(nh2)
P06779 LsIA [Δ1-2] synthetic construct CCSNPACRVNNPNIC(nh2)
P06778 LsIA [Δ1] synthetic construct GCCSNPACRVNNPNIC(nh2)
P02665 LtIA A superfamily Conus litteratus GCCARAACAGIHQELC(nh2)
P04479 LtIA [A4S,A6P] synthetic construct GCCSRPACAGIHQELC(nh2)
P04478 LtIA [A4S] synthetic construct GCCSRAACAGIHQELC(nh2)
P02588 LtXIVA L superfamily Conus litteratus MCPPLCKPSCTNC(nh2)
P04259 LtXIVA [K7A] synthetic construct MCPPLCAPSCTNC(nh2)
P05949 LvIA Conus lividus RGCCSHPACNVDHPEIC(nh2)
P01382 Lys conopressin G Conus imperialis CFIRNCPKG(nh2)
P01266 Lys-conopressin G Conus geographus (Geography cone) CFIRNCPKG(nh2)
P00014 M1A A superfamily Conus magus (Magus cone) DGRCCHPACAKHFNC(nh2)
P00016 M1B A superfamily Conus magus (Magus cone) NGRCCHPACARKYNC(nh2)
P02676 MaI51 O2 superfamily Conus marmoreus QCEDVWMPCTSNWECCSLDCEMYCTQI(nh2)
P00023 MI A superfamily Conus magus (Magus cone) GRCCHPACGKNYSC(nh2)
P04455 MI [H5A] synthetic construct GRCCAPACGKNYSC(nh2)
P04457 MI [K10A] synthetic construct GRCCHPACGANYSC(nh2)
P04458 MI [N11A] synthetic construct GRCCHPACGKAYSC(nh2)
P04456 MI [P6A] synthetic construct GRCCHAACGKNYSC(nh2)
P04454 MI [R2A] synthetic construct GACCHPACGKNYSC(nh2)
P04463 MI [S13A] synthetic construct GRCCHPACGKNYAC(nh2)
P04459 MI [Y12A] synthetic construct GRCCHPACGKNASC(nh2)
P04465 MI [Y12Dit] synthetic construct GRCCHPACGKN(Dit)SC(nh2)
P04461 MI [Y12H] synthetic construct GRCCHPACGKNHSC(nh2)
P04460 MI [Y12M] synthetic construct GRCCHPACGKNMSC(nh2)
P04462 MI [Y12W] synthetic construct GRCCHPACGKNWSC(nh2)
P02593 Mi5.2 T superfamily Conus miles CCPGNFACC(nh2)
P05866 MI[del1G] synthetic construct RCCHPACGKNYSC(nh2)
P05865 MIC Conus magus (Magus cone) CCHPACGKNYSC(nh2)
P00039 MII A superfamily Conus magus (Magus cone) GCCSNPVCHLEHSNLC(nh2)
P04392 MII [E11A,L15A] synthetic construct GCCSNPVCHLAHSNAC(nh2)
P03892 MII [E11A] synthetic construct GCCSNPVCHLAHSNLC(nh2)
P04319 MII [E11R] synthetic construct GCCSNPVCHLRHSNLC(nh2)
P04476 MII [G1A] synthetic construct ACCSNPVCHLEHSNLC(nh2)
P04386 MII [H12A] synthetic construct GCCSNPVCHLEASNLC(nh2)
P04390 MII [H9A,L15A] synthetic construct GCCSNPVCALEHSNAC(nh2)
P04379 MII [H9A] synthetic construct GCCSNPVCALEHSNLC(nh2)
P04391 MII [L10A,L15A] synthetic construct GCCSNPVCHAEHSNAC(nh2)
P04385 MII [L10A] synthetic construct GCCSNPVCHAEHSNLC(nh2)
P04380 MII [L15A] synthetic construct GCCSNPVCHLEHSNAC(nh2)
P04388 MII [N14A] synthetic construct GCCSNPVCHLEHSALC(nh2)
P04382 MII [N5A] synthetic construct GCCSAPVCHLEHSNLC(nh2)
P05527 MII [N5R,E11A,H12K] synthetic construct GCCSRPVCHLAKSNLC(nh2)
P04383 MII [P6A] synthetic construct GCCSNAVCHLEHSNLC(nh2)
P04387 MII [S13A] synthetic construct GCCSNPVCHLEHANLC(nh2)
P04477 MII [S4A,E11A,L15A] synthetic construct GCCANPVCHLAHSNAC(nh2)
P04389 MII [S4A,H9A] synthetic construct GCCANPVCALEHSNLC(nh2)
P04381 MII [S4A] synthetic construct GCCANPVCHLEHSNLC(nh2)
P04384 MII [V7A] synthetic construct GCCSNPACHLEHSNLC(nh2)
P01691 MIIIA Conus magus (Magus cone) ZGCCNVPNGCSGRWCRDHAQCC(nh2)
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
P03638 Mn1.4 Conus monachus GRCCHPACAKYFSC(nh2)
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(BTr)HPTWCPWC(nh2)
P02491 Mr1.1 A superfamily Conus marmoreus GCCSHPACSVNNPDIC(nh2)
P02493 Mr1.2 A superfamily Conus marmoreus GCCSNPPCYANNQAYCN(nh2)
P02494 Mr1.3 A superfamily Conus marmoreus GCCSHPACRVHYPHVCY(nh2)
P06002 Mr1.8a A superfamily Conus marmoreus ECCTHPACHVSNPELC(nh2)
P05431 Mr1.9 M superfamily Conus marmoreus VCCPFGGCHELCTADD(nh2)
P05411 Mr14.6 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE
P05416 Mr3.11 M superfamily Conus marmoreus CCRIACNLKCNOCC(nh2)
P05422 Mr3.12 M superfamily Conus marmoreus LCCWKEWCHARCTCC(nh2)
P05424 Mr3.13 M superfamily Conus marmoreus LCCWIHWCHARCTCC(nh2)
P05433 Mr3.16 M superfamily Conus marmoreus VCCSFGSCDSLCQCCD(nh2)
P02688 Mr3.5 M superfamily Conus marmoreus MGCCPFPCKTSCTTLCC(nh2)
P05378 Mr6.12 O2 superfamily Conus marmoreus GCKATWMSCSSGWECCSMSCDMYC(nh2)
P05373 Mr6.28 O2 superfamily Conus marmoreus QCEDVWMPCTSNWECCSLDCERYCTQI(nh2)
P06932 MrIA [N1Z] synthetic construct ZGVCCGYKLCHOC(nh2)
P04492 MrIA amidated synthetic construct NGVCCGYKLCHPC(nh2)
P02849 MrIB C-term amidated synthetic construct VGVCCGYKLCHOC(nh2)
P06003 MrIC A superfamily Conus marmoreus PECCTHPACHVSNPELC(nh2)
P02696 MrIIID M superfamily Conus marmoreus CCRLSCGLGCHOCC(nh2)
P02697 MrIIIE M superfamily Conus marmoreus VCCPFGGCHELCYCCD(nh2)
P01485 MrIIIF M superfamily Conus marmoreus VCCPFGGCHELCLCCD(nh2)
P02698 MrIIIG M superfamily Conus marmoreus DCCOLPACPFGCNOCC(nh2)
P01624 MVIA O1 superfamily Conus magus (Magus cone) DGCYNAGTFCGIROGLCCSEFCFLWCITFVDS(nh2)
P01623 MVIB O1 superfamily Conus magus (Magus cone) EACYNAGSFCGIHOGLCCSEFCILWCITFVDS(nh2)
P01386 MVIIA O1 superfamily Conus magus (Magus cone) CKGKGAKCSRLMYDCCTGSCRSGKC(nh2)
P04240 MVIIA[K2A] synthetic construct CAGKGAKCSRLMYDCCTGSCRSGKC(nh2)
P01661 MVIIA[R10K] synthetic construct CKGKGAKCSKLMYDCCTGSCRSGKC(nh2)
P04239 MVIIA[Y13A] synthetic construct CKGKGAKCSRLMADCCTGSCRSGKC(nh2)
P01638 MVIIB O1 superfamily Conus magus (Magus cone) CKGKGASCHRTSYDCCTGSCNRGKC(nh2)
P01484 MVIIC Conus magus (Magus cone) CKGKGAPCRKTMYDCCSGSCGRRGKC(nh2)
P01658 MVIIC analog synthetic construct CKGKGAPCRKTMYDCCKGRCGRRGRC(nh2)
P02675 MVIID O1 superfamily Conus magus (Magus cone) CQGRGASCRKTMYNCCSGSCNRGRC(nh2)
P01397 OIVA A superfamily Conus obscurus CCGVONAACHOCVCKNTC(nh2)
P04446 OIVA [H10P] synthetic construct CCGVONAACPOCVCKNTC(nh2)
P04447 OIVA [K15N] synthetic construct CCGVONAACHOCVCNNTC(nh2)
P01688 OIVB A superfamily Conus obscurus CCGVONAACPOCVCNKTCG(nh2)
P00006 OmIA A superfamily Conus omaria GCCSHPACNVNNPHICG(nh2)
P04680 P3.9 M superfamily Conus purpurascens HPPCCMYGRCRRYPGCSSASCCQ(nh2)
P05219 Pc16a Conus pictus SCSCKRNFLCC(nh2)
P05862 Pc16c Conus pictus SCSCQKHFSCCD(nh2)
P02608 PeIA A superfamily Conus pergrandis GCCSHPACSVNHPELC(nh2)
P06804 PeIA[A7V,S9H,V10A,N11R,E14A] synthetic construct GCCSHPVCHARHPALC(nh2)
P06802 PeIA[A7V,S9H,V10A,N11R] synthetic construct GCCSHPVCHARHPELC(nh2)
P06793 PeIA[A7V] synthetic construct GCCSHPVCSVNHPELC(nh2)
P06790 PeIA[E14A] synthetic construct GCCSHPACSVNHPALC(nh2)
P05854 PeIA[E14N] synthetic construct GCCSHPACSVNHPNLC(nh2)
P06787 PeIA[H12A] synthetic construct GCCSHPACSVNAPELC(nh2)
P06782 PeIA[H5A] synthetic construct GCCSAPACSVNHPELC(nh2)
P06792 PeIA[H5N] synthetic construct GCCSNPACSVNHPELC(nh2)
P06791 PeIA[L15A] synthetic construct GCCSHPACSVNHPEAC(nh2)
P06786 PeIA[N11A] synthetic construct GCCSHPACSVAHPELC(nh2)
P06797 PeIA[N11E] synthetic construct GCCSHPACSVEHPELC(nh2)
P06799 PeIA[N11K] synthetic construct GCCSHPACSVKHPELC(nh2)
P06798 PeIA[N11R] synthetic construct GCCSHPACSVRHPELC(nh2)
P06788 PeIA[P13A] synthetic construct GCCSHPACSVNHAELC(nh2)
P06789 PeIA[P13O] synthetic construct GCCSHPACSVNHOELC(nh2)
P06800 PeIA[P13S] synthetic construct GCCSHPACSVNHSELC(nh2)
P06783 PeIA[P6A] synthetic construct GCCSHAACSVNHPELC(nh2)
P06784 PeIA[P6O] synthetic construct GCCSHOACSVNHPELC(nh2)
P06781 PeIA[S4A] synthetic construct GCCAHPACSVNHPELC(nh2)
P06785 PeIA[S9A] synthetic construct GCCSHPACAVNHPELC(nh2)
P06803 PeIA[S9H,V10A,N11R,E14A] synthetic construct GCCSHPACHARHPALC(nh2)
P06801 PeIA[S9H,V10A,N11R] synthetic construct GCCSHPACHARHPELC(nh2)
P05852 PeIA[S9H] synthetic construct GCCSHPACHVNHPELC(nh2)
P06794 PeIA[S9R] synthetic construct GCCSHPACRVNHPELC(nh2)
P05853 PeIA[V10A] synthetic construct GCCSHPACSANHPELC(nh2)
P06796 PeIA[V10L] synthetic construct GCCSHPACSLNHPELC(nh2)
P06795 PeIA[V10R] synthetic construct GCCSHPACSRNHPELC(nh2)
P00595 PIA A superfamily Conus purpurascens RDPCCSNPVCTVHNPQIC(nh2)
P04310 PIA Δ1 synthetic construct DPCCSNPVCTVHNPQIC(nh2)
P04311 PIA Δ1-2 synthetic construct PCCSNPVCTVHNPQIC(nh2)
P04312 PIA Δ1-3 synthetic construct CCSNPVCTVHNPQIC(nh2)
P04313 PIA [R1ADMA] synthetic construct (ADMA)DPCCSNPVCTVHNPQIC(nh2)
P04316 PIA [R1E] synthetic construct EDPCCSNPVCTVHNPQIC(nh2)
P04314 PIA [R1K] synthetic construct KDPCCSNPVCTVHNPQIC(nh2)
P04315 PIA [R1L] synthetic construct LDPCCSNPVCTVHNPQIC(nh2)
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P02228 PIIIA M superfamily Conus purpurascens ZRLCCGFOKSCRSRQCKOHRCC(nh2)
P04296 PIIIA [G6K] synthetic construct ZRLCCKFOKSCRSRQCKOHRCC(nh2)
P04300 PIIIA [K17A] synthetic construct ZRLCCAFOKSCRSRQCAOHRCC(nh2)
P04301 PIIIA [K17Q] synthetic construct ZRLCCAFOKSCRSRQCQOHRCC(nh2)
P04294 PIIIA [K17R] synthetic construct ZRLCCGFOKSCRSRQCROHRCC(nh2)
P04297 PIIIA [R12A] synthetic construct ZRLCCAFOKSCASRQCKOHRCC(nh2)
P04293 PIIIA [R12K] synthetic construct ZRLCCGFOKSCKSRQCKOHRCC(nh2)
P04298 PIIIA [R12Q] synthetic construct ZRLCCAFOKSCQSRQCKOHRCC(nh2)
P04290 PIIIA [R14A] synthetic construct ZRLCCGFOKSCRSAQCKOHRCC(nh2)
P04292 PIIIA [R14K] synthetic construct ZRLCCGFOKSCRSKQCKOHRCC(nh2)
P04291 PIIIA [R14Q] synthetic construct ZRLCCGFOKSCRSQQCKOHRCC(nh2)
P04302 PIIIA [R20A] synthetic construct ZRLCCAFOKSCRSRQCKOHACC(nh2)
P04295 PIIIA [R2A] synthetic construct ZALCCGFOKSCRSRQCKOHRCC(nh2)
P04299 PIIIA [S13D] synthetic construct ZRLCCAFOKSCRDRQCKOHRCC(nh2)
P01611 PIIIE M superfamily Conus purpurascens HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04448 PIIIE [K9S] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P04449 PIIIE [R12O,Y13F] synthetic construct HOOCCLYGKCROFOGCSSASCCQR(nh2)
P04450 PIIIE [S17Y,S18N,S20L] synthetic construct HOOCCLYGKCRRYOGCSSASCCQR(nh2)
P01594 PIIIF M superfamily Conus purpurascens GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04452 PIIIF [O12R,F13Y] synthetic construct GOOCCLYGSCRRYOGCYNALCCRK(nh2)
P04451 PIIIF [S9K] synthetic construct GOOCCLYGSCROFOGCYNALCCRK(nh2)
P04453 PIIIF [Y17S,N18S,L20S] synthetic construct GOOCCLYGSCROFOGCSSASCCRK(nh2)
P01449 PIVA A superfamily Conus purpurascens GCCGSYONAACHOCSCKDROSYCGQ(nh2)
P01612 PIVA [Hyp7P,Hyp13P] synthetic construct GCCGSYPNAACHPCSCKDROSYCGQ(nh2)
P01670 PIVE Conus purpurascens DCCGVKLEMCHPCLCDNSCKNYGK(nh2)
P01669 PIVF Conus purpurascens DCCGVKLEMCHPCLCDNSCKKSGK(nh2)
P02605 Pl14.1 J superfamily Conus planorbis GPGSAICNMACRLGQGHMYPFCNCN(nh2)
P02606 Pl14.2 J superfamily Conus planorbis GPGSAICNMACRLEHGHLYPFCHCR(nh2)
P02607 Pl14.3 J superfamily Conus planorbis GPGSAICNMACRLEHGHLYPFCNCD(nh2)
P01539 PlXIVA J superfamily Conus planorbis FPRPRICNLACRAGIGHKYPFCHCR(nh2)
P02700 Pn-0111 T superfamily Conus pennaceus MCCLGTSGCCPW(nh2)
P02701 Pn-014 T superfamily Conus pennaceus YDCCKTFECCHW(nh2)
P02702 Pn-B01121 T superfamily Conus pennaceus YCCVYDYSCCLSW(nh2)
P02704 Pn-B01411 T superfamily Conus pennaceus CCYETPGCCVI(nh2)
P02706 Pn-B02 T superfamily Conus pennaceus ECCSDGWCCPA(nh2)
P00075 Pni1 synthetic construct GCCSLPPCAANNPDYC(nh2)
P00051 PnIA A superfamily Conus pennaceus GCCSLPPCAANNPD(sTy)C(nh2)
P00505 PnIA [A10L,D14K,sTy15Y] synthetic construct GCCSLPPCALNNPKYC(nh2)
P04375 PnIA [A10L,sTy15Y] synthetic construct GCCSLPPCALNNPDYC(nh2)
P04444 PnIA [L5R,A10L] synthetic construct GCCSRPPCALNNPD(sTy)C(nh2)
P04376 PnIA [N11S,sTy15Y] synthetic construct GCCSLPPCAASNPDYC(nh2)
P04433 PnIA [P6A(S)Pro] synthetic construct GCCSL(A(S)Pro)PCAANNPD(sTy)C(nh2)
P04432 PnIA [P6APro] synthetic construct GCCSL(APro)PCAANNPD(sTy)C(nh2)
P04440 PnIA [P6benzPro] synthetic construct GCCSL(benz-Pro)PCAANNPD(sTy)C(nh2)
P04435 PnIA [P6betPro] synthetic construct GCCSL(bet-Pro)PCAANNPD(sTy)C(nh2)
P04437 PnIA [P6fluo(S)Pro] synthetic construct GCCSL(F-(S)-Pro)PCAANNPD(sTy)C(nh2)
P04436 PnIA [P6fluoPro] synthetic construct GCCSL(F-Pro)PCAANNPD(sTy)C(nh2)
P04434 PnIA [P6guaPro] synthetic construct GCCSL(Gua-Pro)PCAANNPD(sTy)C(nh2)
P04441 PnIA [P6naphPro] synthetic construct GCCSL(naph-Prot)PCAANNPD(sTy)C(nh2)
P04431 PnIA [P6O] synthetic construct GCCSLOPCAANNPD(sTy)C(nh2)
P04442 PnIA [P6phi(3S)Pro] synthetic construct GCCSL(phi3-Pro)PCAANNPD(sTy)C(nh2)
P04443 PnIA [P6phi(5R)Pro] synthetic construct GCCSL(phi5-Pro)PCAANNPD(sTy)C(nh2)
P04439 PnIA [P6phi(S)Pro] synthetic construct GCCSL(phi-(S)-Pro)PCAANNPD(sTy)C(nh2)
P04438 PnIA [P6phiPro] synthetic construct GCCSL(phi-Pro)PCAANNPD(sTy)C(nh2)
P04377 PnIA [sTy15Y] synthetic construct GCCSLPPCAANNPDYC(nh2)
P00099 PnIB A superfamily Conus pennaceus GCCSLPPCALSNPD(sTy)C(nh2)
P04378 PnIB [sTy15Y] synthetic construct GCCSLPPCALSNPDYC(nh2)
P04211 Pr3b Conus parius ERVCCGYOMSCKSRACKOSYCC(nh2)
P02832 PrIIIE M superfamily Conus parius AARCCTYHGSCLKEKCRRKYCC(nh2)
P02519 Pu1.1 A superfamily Conus pulicarius QNCCNVPGCWAKYKHLC(nh2)
P02520 Pu1.2 A superfamily Conus pulicarius GGCCSYPPCIANNPLC(nh2)
P02790 Pu5.1 T superfamily Conus pulicarius SCCPSPTSCCPW(nh2)
P02792 Pu5.2 T superfamily Conus pulicarius GCCEDKTCCFI(nh2)
P02796 Pu5.4 T superfamily Conus pulicarius SCCPEEITCCPW(nh2)
P02596 PVA T superfamily Conus purpurascens GCCPKQMRCCTL(nh2)
P02595 PVIA O1 superfamily Conus purpurascens EACYAOGTFCGIKOGLCCSEFCLPGVCFG(nh2)
P01356 PVIIA O1 superfamily Conus purpurascens CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04364 PVIIA [D13A] synthetic construct CRIONQKCFQHLADCCSRKCNRFNKCV(nh2)
P04369 PVIIA [F23A] synthetic construct CRIONQKCFQHLDDCCSRKCNRANKCV(nh2)
P04359 PVIIA [F9A] synthetic construct CRIONQKCAQHLDDCCSRKCNRFNKCV(nh2)
P04360 PVIIA [F9M] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04361 PVIIA [F9Y] synthetic construct CRIONQKCYQHLDDCCSRKCNRFNKCV(nh2)
P04363 PVIIA [H11A] synthetic construct CRIONQKCFQALDDCCSRKCNRFNKCV(nh2)
P04355 PVIIA [I3A] synthetic construct CRAONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04367 PVIIA [K19A] synthetic construct CRIONQKCFQHLDDCCSRACNRFNKCV(nh2)
P04371 PVIIA [K25A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFNACV(nh2)
P04357 PVIIA [K7A] synthetic construct CRIONQACFQHLDDCCSRKCNRFNKCV(nh2)
P04358 PVIIA [K7R] synthetic construct CRIONQRCFQHLDDCCSRKCNRFNKCV(nh2)
P04370 PVIIA [N24A] synthetic construct CRIONQKCFQHLDDCCSRKCNRFAKCV(nh2)
P04362 PVIIA [Q10A] synthetic construct CRIONQKCFAHLDDCCSRKCNRFNKCV(nh2)
P04356 PVIIA [Q6A] synthetic construct CRIONAKCFQHLDDCCSRKCNRFNKCV(nh2)
P04366 PVIIA [R18A] synthetic construct CRIONQKCFQHLDDCCSAKCNRFNKCV(nh2)
P04368 PVIIA [R22A] synthetic construct CRIONQKCFQHLDDCCSRKCNAFNKCV(nh2)
P04352 PVIIA [R2A] synthetic construct CAIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04354 PVIIA [R2K] synthetic construct CKIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04353 PVIIA [R2Q] synthetic construct CQIONQKCFQHLDDCCSRKCNRFNKCV(nh2)
P04365 PVIIA [S17A] synthetic construct CRIONQKCFQHLDDCCARKCNRFNKCV(nh2)
P02511 Qc1.2 A superfamily Conus quercinus QCCANPPCKHVNC(nh2)
P02513 Qc1.4 A superfamily Conus quercinus QGCCSDPACAVSNPDIC(nh2)
P02514 Qc1.4a A superfamily Conus quercinus DGCCSNPSCSVNNPDIC(nh2)
P02515 Qc1.4b A superfamily Conus quercinus DGCCPNPSCSVNNPDIC(nh2)
P02516 Qc1.5 A superfamily Conus quercinus GCCSNPACSVNHPELC(nh2)
P02517 Qc1.6 A superfamily Conus quercinus GCCSNPTCAGNNGNIC(nh2)
P01514 QcIIIA M superfamily Conus quercinus CCSQDCLVCIOCCPN(nh2)
P01513 QcIIIB M superfamily Conus quercinus CCSRHCWVCIOCCPN(nh2)
P04317 RDP-MII synthetic construct RDPGCCSNPVCHLEHSNLC(nh2)
P04320 RDP-MII [E11R] synthetic construct RDPGCCSNPVCHLRHSNLC(nh2)
P04318 RDP-MII [R1ADMA] synthetic construct (ADMA)DPGCCSNPVCHLEHSNLC(nh2)
P01493 Reg12e M superfamily Conus regius KCCMRPICTCOCCIGP(nh2)
P00028 Reg1b/Reg1c A superfamily Conus regius GCCSDORCKHQC(nh2)
P00029 Reg1d A superfamily Conus regius GCCSDPRCKHEC(nh2)
P00030 Reg1e A superfamily Conus regius GCCSDORCRYRC(nh2)
P00031 Reg1f A superfamily Conus regius DYCCRROOCTLIC(nh2)
P00032 RegIIA A superfamily Conus regius GCCSHPACNVNNPHIC(nh2)
P02591 RIIIK M superfamily Conus radiatus LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04337 RIIIK [K18A] synthetic construct LOSCCSLNLRLCOVOACARNOCCT(nh2)
P04339 RIIIK [K18R, R19K] synthetic construct LOSCCSLNLRLCOVOACRKNOCCT(nh2)
P04333 RIIIK [L11A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04325 RIIIK [L1A] synthetic construct AOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04344 RIIIK [L1E] synthetic construct EOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04350 RIIIK [L1F] synthetic construct FOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04345 RIIIK [L1H] synthetic construct HOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04346 RIIIK [L1I] synthetic construct IOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04348 RIIIK [L1K] synthetic construct KOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04347 RIIIK [L1M] synthetic construct MOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04349 RIIIK [L1R] synthetic construct ROSCCSLNLRLCOVOACKRNOCCT(nh2)
P04351 RIIIK [L1Y] synthetic construct YOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04329 RIIIK [L7A] synthetic construct LOSCCSANLRLCOVOACKRNOCCT(nh2)
P04331 RIIIK [L9A] synthetic construct LOSCCSLNARLCOVOACKRNOCCT(nh2)
P04340 RIIIK [N20A] synthetic construct LOSCCSLNLRLCOVOACKRAOCCT(nh2)
P04330 RIIIK [N8A] synthetic construct LOSCCSLALRLCOVOACKRNOCCT(nh2)
P04334 RIIIK [O13A] synthetic construct LOSCCSLNLRLCAVOACKRNOCCT(nh2)
P04336 RIIIK [O15A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P04341 RIIIK [O21A] synthetic construct LOSCCSLNLRLCOVOACKRNACCT(nh2)
P04326 RIIIK [O2A] synthetic construct LASCCSLNLRLCOVOACKRNOCCT(nh2)
P04332 RIIIK [R10A] synthetic construct LOSCCSLNLALCOVOACKRNOCCT(nh2)
P04338 RIIIK [R19A] synthetic construct LOSCCSLNLRLCOVOACKANOCCT(nh2)
P04327 RIIIK [S3A] synthetic construct LOACCSLNLRLCOVOACKRNOCCT(nh2)
P04328 RIIIK [S6A] synthetic construct LOSCCALNLRLCOVOACKRNOCCT(nh2)
P04342 RIIIK [T24A] synthetic construct LOSCCSLNLRLCOVOACKRNOCCA(nh2)
P04335 RIIIK [V14A] synthetic construct LOSCCSLNLRLCOAOACKRNOCCT(nh2)
P04238 RIIIKΔ9 synthetic construct LOSCCSLNLRLCOVOACKRNOCCT(nh2)
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
P02522 S1.1 A superfamily Conus striatus (Striated cone) NGCCRNPACESHRC(nh2)
P02482 Scratcher peptide Conus geographus (Geography cone) KFLSGGFK(Gla)IVCHRYCAKGIAKEFCNCPD(nh2)
P00001 SI A superfamily Conus striatus (Striated cone) ICCNPACGPKYSC(nh2)
P04400 SI [K10H] synthetic construct ICCNPACGPHYSC(nh2)
P04401 SI [K10N] synthetic construct ICCNPACGPNYSC(nh2)
P04399 SI [P9K] synthetic construct ICCNPACGKKYSC(nh2)
P00025 SIA A superfamily Conus striatus (Striated cone) YCCHPACGKNFDC(nh2)
P02707 SIIIA M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCRDHARCC(nh2)
P05703 SIIIA[C3U,C13U] synthetic construct ZNUCNGGCSSKWURDHARCC(nh2)
P05702 SIIIA[C4U,C19U] synthetic construct ZNCUNGGCSSKWCRDHARUC(nh2)
P05704 SIIIA[C8U,C20U] synthetic construct ZNCCNGGUSSKWCRDHARCU(nh2)
P05815 SIIIA[del1,D15A,add21A,add22A] synthetic construct NCCNGGCSSKWCRAHARCCAA(nh2)
P05819 SIIIA[del1,D15A,add21A,add22D] synthetic construct NCCNGGCSSKWCRAHARCCAD(nh2)
P05817 SIIIA[del1,D15A,add21A,add22K] synthetic construct NCCNGGCSSKWCRAHARCCAK(nh2)
P05814 SIIIA[del1,D15A,add21A] synthetic construct NCCNGGCSSKWCRAHARCCA(nh2)
P05818 SIIIA[del1,D15A,add21D] synthetic construct NCCNGGCSSKWCRAHARCCD(nh2)
P05816 SIIIA[del1,D15A,add21K] synthetic construct NCCNGGCSSKWCRAHARCCK(nh2)
P05813 SIIIA[del1,D15A] synthetic construct NCCNGGCSSKWCRAHARCC(nh2)
P05812 SIIIA[del1] synthetic construct NCCNGGCSSKWCRDHARCC(nh2)
P01615 SIIIB M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCKGHARCC(nh2)
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02525 SIVB A superfamily Conus striatus (Striated cone) ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO
P02980 Sm1.1 A superfamily Conus stercusmuscarum GRCCHPACGONYSC(nh2)
P02903 Sm1.3 A superfamily Conus stercusmuscarum GCCSNPVCHLEHSN(Mox)C(nh2)
P05838 Sm1.4 Conus stercusmuscarum I(Mox)YDCCSGSCSGYTGRC(nh2)
P02530 SmIVA A superfamily Conus stercusmuscarum ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK
P02529 SmIVB A superfamily Conus stercusmuscarum ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK
P01540 SO3 O1 superfamily Conus striatus (Striated cone) CKAAGKPCSRIAYNCCTGSCRSGKC(nh2)
P03902 Sr1.1 synthetic construct RTCCSROTCRMEYPELCG(nh2)
P03646 Sr5.6/Sr5.8 T superfamily Conus spurius IMAGCCPRFYQCCYP(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P04445 SrIB [Gla15E] synthetic construct RTCCSROTCRMEYPELCG(nh2)
P01450 SrVIIA O1 superfamily Conus spurius CLQFGSTCFLGDDDICCSGECFYSGGTFGICS(nh2)
P02802 SrXIA I2 superfamily Conus spurius CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2)
P01794 SVIA O1 superfamily Conus striatus (Striated cone) CRSSGSOCGVTSICCGRCYRGKCT(nh2)
P01793 SVIB O1 superfamily Conus striatus (Striated cone) CKLKGQSCRKTSYDCCSGSCGRSGKC(nh2)
P03584 SxIIIA M superfamily Conus striolatus RCCTGKKGSCSGRACKNLKCCA(nh2)
P03585 SxIIIB M superfamily Conus striolatus ZKCCTGKKGSCSGRACKNLRCCA(nh2)
P02568 TeAr151 T superfamily Conus textile (Cloth-of-gold cone) VCCRPMQDCCS(nh2)
P01810 Textile convulsant peptide O1 superfamily Conus textile (Cloth-of-gold cone) NCPYCVVYCCPPAYCEASGCRPP(nh2)
P01634 TIA A superfamily Conus tulipa (tulip cone) FNWRCCLIPACRRNHKKFC(nh2)
P04228 TiIA Conus tinianus GGCCSHPACQNNPD(sTy)C(nh2)
P01616 TIIIA M superfamily Conus tulipa (tulip cone) RHGCCKGOKGCSSRECROQHCC(nh2)
P05822 TIIIA[E15A,add23A,add24A] synthetic construct RHGCCKGOKGCSSRACROQHCCAA(nh2)
P05826 TIIIA[E15A,add23A,add24D] synthetic construct RHGCCKGOKGCSSRACROQHCCAD(nh2)
P05825 TIIIA[E15A,add23A,add24K] synthetic construct RHGCCKGOKGCSSRACROQHCCAK(nh2)
P05821 TIIIA[E15A,add23A] synthetic construct RHGCCKGOKGCSSRACROQHCCA(nh2)
P05824 TIIIA[E15A,add23D] synthetic construct RHGCCKGOKGCSSRACROQHCCD(nh2)
P05823 TIIIA[E15A,add23K] synthetic construct RHGCCKGOKGCSSRACROQHCCK(nh2)
P05820 TIIIA[E15A] synthetic construct RHGCCKGOKGCSSRACROQHCC(nh2)
P02712 Ts-011 T superfamily Conus tessulatus GCCEDKTCCFI(nh2)
P02715 Tx-D021 T superfamily Conus textile (Cloth-of-gold cone) SGCCVIDSNCC(nh2)
P02716 Tx1 A superfamily Conus textile (Cloth-of-gold cone) PECCSDPRCNSSHPELCG(nh2)
P03755 Tx10b Conus textile (Cloth-of-gold cone) DPCCGYRMCVOC(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P03753 Tx1c Conus textile (Cloth-of-gold cone) GCCSRPPCIANNPDIC(nh2)
P02560 Tx3a M superfamily Conus textile (Cloth-of-gold cone) CCSWDVCDHPSCTCCG(nh2)
P02564 Tx3f M superfamily Conus textile (Cloth-of-gold cone) RCCKFPCPDSCRYLCC(nh2)
P02565 Tx3h M superfamily Conus textile (Cloth-of-gold cone) KFCCDSNWCHISDCECCY(nh2)
P05831 Tx3i Conus textile (Cloth-of-gold cone) CCGOTACLAGCKPCC(nh2)
P02561 Tx5.1 T superfamily Conus textile (Cloth-of-gold cone) CCQTFYWCCVQ(nh2)
P05827 Tx5.2 Conus textile (Cloth-of-gold cone) CCPPVIWCC(nh2)
P05828 Tx5.3 Conus textile (Cloth-of-gold cone) QTCCGSKVFCC(nh2)
P05833 Tx5.5 Conus textile (Cloth-of-gold cone) NIQIICCKHTPKCCT(nh2)
P03756 Tx5c Conus textile (Cloth-of-gold cone) KPCCSIHDNSCCGI(nh2)
P03758 Tx5d Conus textile (Cloth-of-gold cone) NIQIICCKHTPACCT(nh2)
P05864 Tx5e Conus textile (Cloth-of-gold cone) PCCSKLHDNSCCGL(nh2)
P05837 Tx6.6 O1 superfamily Conus textile (Cloth-of-gold cone) DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA(nh2)
P02881 TxIA A superfamily Conus textile (Cloth-of-gold cone) GCCSROOCIANNPDLC(nh2)
P05345 TxIB Conus textile (Cloth-of-gold cone) GCCSDPPCRNKHPDLC(nh2)
P05832 TxIC T superfamily Conus textile (Cloth-of-gold cone) DKQTCCGYRMCVOC(nh2)
P06831 TxID Conus textile (Cloth-of-gold cone) GCCSHPVCSAMSPIC(nh2)
P02563 TxIIIB M superfamily Conus textile (Cloth-of-gold cone) CCPPVACNMGCKPCC(nh2)
P02562 TxIIIC M superfamily Conus textile (Cloth-of-gold cone) CCRTCFGCTOCC(nh2)
P02559 TxIXA P superfamily Conus textile (Cloth-of-gold cone) GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2)
P03170 TxMLKM-021 M superfamily Conus textile (Cloth-of-gold cone) VCCPFGGCHELCQCCE(nh2)
P01517 TxVIIA O2 superfamily Conus textile (Cloth-of-gold cone) CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2)
P02551 TxX I2 superfamily Conus textile (Cloth-of-gold cone) SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS
P02552 TxXI I2 superfamily Conus textile (Cloth-of-gold cone) CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2)
P00004 Vc1.1 synthetic construct GCCSDPRCNYDHPEIC(nh2)
P06292 Vc1.1 [Cys2Agl,Cys8Agl] synthetic construct G(Agl)CSDPR(Agl)NYDHPEIC(nh2)
P06293 Vc1.1 [Cys3Agl,Cys16Agl] synthetic construct GC(Agl)SDPRCNYDHPEI(Agl)(nh2)
P04467 Vc1.1 [E14Gla] synthetic construct GCCSDPRCNYDHP(Gla)IC(nh2)
P04466 Vc1.1 [P6O] synthetic construct GCCSDORCNYDHPEIC(nh2)
P03654 Vc1.1[D11A] synthetic construct GCCSDPRCNYAHPEIC(nh2)
P03665 Vc1.1[D11K] synthetic construct GCCSDPRCNYKHPEIC(nh2)
P03649 Vc1.1[D5A] synthetic construct GCCSAPRCNYDHPEIC(nh2)
P03661 Vc1.1[D5K] synthetic construct GCCSKPRCNYDHPEIC(nh2)
P03657 Vc1.1[E14A] synthetic construct GCCSDPRCNYDHPAIC(nh2)
P03679 Vc1.1[E14D] synthetic construct GCCSDPRCNYDHPDIC(nh2)
P03668 Vc1.1[E14K] synthetic construct GCCSDPRCNYDHPKIC(nh2)
P03647 Vc1.1[G1A] synthetic construct ACCSDPRCNYDHPEIC(nh2)
P03671 Vc1.1[G1D] synthetic construct DCCSDPRCNYDHPEIC(nh2)
P03659 Vc1.1[G1K] synthetic construct KCCSDPRCNYDHPEIC(nh2)
P03655 Vc1.1[H12A] synthetic construct GCCSDPRCNYDAPEIC(nh2)
P03677 Vc1.1[H12D] synthetic construct GCCSDPRCNYDDPEIC(nh2)
P03666 Vc1.1[H12K] synthetic construct GCCSDPRCNYDKPEIC(nh2)
P03658 Vc1.1[I15A] synthetic construct GCCSDPRCNYDHPEAC(nh2)
P03680 Vc1.1[I15D] synthetic construct GCCSDPRCNYDHPEDC(nh2)
P03669 Vc1.1[I15K] synthetic construct GCCSDPRCNYDHPEKC(nh2)
P03652 Vc1.1[N9A] synthetic construct GCCSDPRCAYDHPEIC(nh2)
P03675 Vc1.1[N9D] synthetic construct GCCSDPRCDYDHPEIC(nh2)
P05356 Vc1.1[N9F] synthetic construct GCCSDPRCFYDHPEIC(nh2)
P03683 Vc1.1[N9G] synthetic construct GCCSDPRCGYDHPEIC(nh2)
P03681 Vc1.1[N9I] synthetic construct GCCSDPRCIYDHPEIC(nh2)
P03664 Vc1.1[N9K] synthetic construct GCCSDPRCKYDHPEIC(nh2)
P03682 Vc1.1[N9L] synthetic construct GCCSDPRCLYDHPEIC(nh2)
P05357 Vc1.1[N9W] synthetic construct GCCSDPRCWYDHPEIC(nh2)
P03656 Vc1.1[P13A] synthetic construct GCCSDPRCNYDHAEIC(nh2)
P03678 Vc1.1[P13D] synthetic construct GCCSDPRCNYDHDEIC(nh2)
P03667 Vc1.1[P13K] synthetic construct GCCSDPRCNYDHKEIC(nh2)
P03650 Vc1.1[P6A] synthetic construct GCCSDARCNYDHPEIC(nh2)
P03673 Vc1.1[P6D] synthetic construct GCCSDDRCNYDHPEIC(nh2)
P03662 Vc1.1[P6K] synthetic construct GCCSDKRCNYDHPEIC(nh2)
P03651 Vc1.1[R7A] synthetic construct GCCSDPACNYDHPEIC(nh2)
P03674 Vc1.1[R7D] synthetic construct GCCSDPDCNYDHPEIC(nh2)
P03663 Vc1.1[R7K] synthetic construct GCCSDPKCNYDHPEIC(nh2)
P03648 Vc1.1[S4A] synthetic construct GCCADPRCNYDHPEIC(nh2)
P03672 Vc1.1[S4D] synthetic construct GCCDDPRCNYDHPEIC(nh2)
P03685 Vc1.1[S4K,N9A] synthetic construct GCCKDPRCAYDHPEIC(nh2)
P03660 Vc1.1[S4K] synthetic construct GCCKDPRCNYDHPEIC(nh2)
P03684 Vc1.1[S4R] synthetic construct GCCRDPRCNYDHPEIC(nh2)
P03653 Vc1.1[Y10A] synthetic construct GCCSDPRCNADHPEIC(nh2)
P03676 Vc1.1[Y10D] synthetic construct GCCSDPRCNDDHPEIC(nh2)
P03670 Vc1.1[Y10K] synthetic construct GCCSDPRCNKDHPEIC(nh2)
P04279 Vc6.17 O2 superfamily Conus victoriae LCPDYTDPCSNAYECCSWNCHNGHCT(nh2)
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02540 VcVA T superfamily Conus victoriae CCPGKOCCRI(nh2)
P02541 VcVB T superfamily Conus victoriae CCQTFYWCCGQ(nh2)
P04511 Vi11.2 I2 superfamily Conus virgo CLRDGQSCGYDSDCCRYSCCWGYCDLTCLII(nh2)
P04515 Vi11.3 I2 superfamily Conus virgo CFPPGVYCTRHLPCCRGRCCSGWCRPRCFPRF(nh2)
P04514 Vi11.5 I2 superfamily Conus virgo CRLEGSSCRRSYQCCHKSCCIRECKFPCRWV(nh2)
P02788 Vi1361 Conus virgo ZCCPTMPECCRI(nh2)
P04519 Vi6.7 O3 superfamily Conus virgo TVDEACNEYCEERNKNCCGRTDGEPVCAQACL(nh2)
P01672 ViVA T superfamily Conus virgo ZCCITIPECCRI(nh2)
P01671 ViVB T superfamily Conus virgo ZCCPTIPECCRV(nh2)
P02836 ViXVA V superfamily Conus virgo DCTTCAGEECCGRCTCPWGDNCSCIEW(nh2)
P04985 Vr3-T05 M superfamily Conus varius EIILHALGTRCCSWDVCDHPSCTCC(nh2)
P02837 Vt15.1 V superfamily Conus vitulinus ACHTCDDGTECCDSRCSCPWNTCTCIPW(nh2)
P04220 Vt3.1 M superfamily Conus vitulinus GPYRRYGNCYCPI(nh2)
P04233 Vt3.2 M superfamily Conus vitulinus GPYRRHGNCFCPS(nh2)