Protein List

Your search: PTM in [D-methionine]

Found 2 entries.


ID Name Gene superfamily Organism Sequence
P00835 R11.2 I1 superfamily Conus radiatus GAVPCGKDGRQCRNHADCCNCCPIGTCAPSTNWILPGCSTG
PFmTR
P01420 M11.1a I1 superfamily Conus magus (Magus cone) GAVPCGKDGRQCRNHADCCNCCPIGTCAPSTNWILPGCSTG
QFmTR