Protein List

Your search: PTM in [Gamma carboxylic glutamic acid]

Found 102 entries.


ID Name Gene superfamily Organism Sequence
P01473 AsVIIA O1 superfamily Conus austini TCKQKGEGCSLDV(Gla)CCSSSCKPGGPLFDFDC
P01811 Bromosleeper peptide O3 superfamily Conus radiatus (BTr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW
QCV(Gla)ACPV
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
HP(nh2)
P04590 Bu27 Conus bullatus AO(Gla)LVVTATTTCCGYDOMTICOOCMCTHSCOOKRKO(nh2)
P04921 Cl9a Conus californicus TFEPNA(Gla)(Gla)CIVDGRCKHRSDWPC(Gla)MSSGT
TGRCDVSLGACGCSN
P03641 Conantokin-Br B1 superfamily Conus sulcatus GD(Gla)(Gla)YSKFI(Gla)RER(Gla)AGRLDLSKFP
P03691 conantokin-Br [R5−6] synthetic construct GD(Gla)(Gla)VAKFI(Gla)RER(Gla)AGRLDLSKFP
P03689 conantokin-Br [R7−10] synthetic construct GD(Gla)(Gla)YSKMA(Gla)ERE(Gla)EAGRLDLSKFP
P03693 conantokin-Br [Y5V] synthetic construct GD(Gla)(Gla)VSKFI(Gla)RER(Gla)AGRLDLSKFP
P03687 Conantokin-Br/R synthetic construct GD(Gla)(Gla)YSKFI(Gla)LAR(Gla)NIAKGCKVNCY
P
P03534 Conantokin-E B1 superfamily Conus ermineus (Atlantic fish-hunting cone) GE(Gla)(Gla)HSKYQ(Gla)CLR(Gla)IRVNNVQQ(Gla)
C
P01338 Conantokin-G B1 superfamily Conus geographus (Geography cone) GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2)
P05699 Conantokin-G[+10Gla,Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Gla)(Buc)LIR(Buc)KS
N(nh2)
P05698 Conantokin-G[Gla10Bsc,Gla14Bsc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Bsc)LIR(Bsc)KSN(nh2)
P05697 Conantokin-G[Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Buc)LIR(Buc)KSN(nh2)
P05700 Conantokin-G[Gla7Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Huc)NQ(Gla)LIR(Buc)KSN(nh2)
P02637 Conantokin-L B1 superfamily Conus lynceus GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)DAVN(nh2)
P03532 Conantokin-P B1 superfamily Conus purpurascens GE(Gla)(Gla)HSKYQ(Gla)CLR(Gla)IRVNKVQQ(Gla)
C
P03537 Conantokin-Pr1 Conus parius GED(Gla)YA(Gla)GIR(Gla)YQLIHGKI
P03536 Conantokin-Pr2 Conus parius DEP(Gla)YA(Gla)AIR(Gla)YQLKYGKI
P03535 Conantokin-Pr3 Conus parius GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2)
P02594 Conantokin-R B1 superfamily Conus radiatus GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)NIAKGCKVNC
YP
P03692 conantokin-R [Br5−6] synthetic construct GE(Gla)(Gla)YSKMA(Gla)ELA(Gla)ENIAKGCKVNC
YP
P03690 conantokin-R [Br7−9] synthetic construct GE(Gla)(Gla)VAKFI(Gla)LAR(Gla)NIAKGCKVNCY
P
P03694 conantokin-R [V5Y] synthetic construct GE(Gla)(Gla)YAKMA(Gla)ELARENIAKGCKVNCYP
P03688 Conantokin-R/Br synthetic construct GE(Gla)(Gla)VAKMA(Gla)ERE(Gla)EAGRLDLSKFP
P05842 conantokin-Rl1 B1 superfamily Conus rolani AD(Gla)(Gla)YLKFI(Gla)EQRKQGKLDPTKFP
P05841 Conantokin-Rl2 B1 superfamily Conus rolani GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05846 Conantokin-Rl2[delO10] synthetic construct GE(Gla)(Gla)LA(Gla)KA(Gla)FAR(Gla)LAN(nh2)
P05848 Conantokin-Rl2[K8N,A9Q,del10O] synthetic construct GE(Gla)(Gla)LA(Gla)NQ(Gla)FAR(Gla)LAN(nh2)
P05847 Conantokin-Rl2[K8Nle] synthetic construct GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA
N(nh2)
P05844 Conantokin-Rl2[L5Y] synthetic construct GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05845 conantokin-Rl2[O10A] synthetic construct GE(Gla)(Gla)LA(Gla)KAA(Gla)FAR(Gla)LAN(nh2)
P05851 Conantokin-Rl3 B1 superfamily Conus rolani GE(Gla)(Gla)LS(Gla)NAV(Gla)FAR(Gla)LAN(nh2)
P01269 Conantokin-T Conus tulipa (tulip cone) GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2)
P03538 Conorfamide-Sr2 Conus spurius GPM(Gla)DPL(Gla)IIRI(nh2)
P01268 conotoxin-GS O1 superfamily Conus geographus (Geography cone) ACSGRGSRCOOQCCMGLRCGRGNPQKCIGAH(Gla)DV
P02570 contryphan-M O2 superfamily Conus marmoreus N(Gla)S(Gla)CPwHPWC(nh2)
P03589 Cp20.2 D superfamily Conus capitaneus DVR(Gla)CQVDTPGSSWGKCCMTRMCGTMCCSRSVCTCVY
HWRRGHGCSCPG
P03591 Cp20.3 D superfamily Conus capitaneus (Gla)VQ(Gla)CQVDTOGSSWGKCCMTRMCGTMCCSRSVC
TCVYHWRRGHGCSCPG
P03593 Cp20.4 D superfamily Conus capitaneus ND(Gla)S(Gla)CIISTPGSSWGRCCLTRMCGTMCCPRSG
CYCVYHWRRGHGCACSD
P03595 Cp20.5 D superfamily Conus capitaneus DNEA(Gla)CQIDTOGSSWGKCCMTRMCGTMCCSRSVCTCV
YHWRRGHGCSCPG
P03629 De7b Conus delessertii DCIOGG(Gla)NCDVFROYRCCSGYCILLLCA
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P02843 Di19A Divergent MSTLGMTLL- Conus distans GCDOTDGCQTTVC(Gla)TDTGOCCCKPNFTCQISNSGTKS
CSCSGQOSDCOV
P01307 Gamma-conopressin-vil Conus villepinii CLIQDCP(Gla)G(nh2)
P00098 GID A superfamily Conus geographus (Geography cone) IRD(Gla)CCSNPACRVNNOHVC
P04481 GID [R12A] synthetic construct IRD(Gla)CCSNPACAVNNOHVC
P03565 GID[R12A] synthetic construct IRD(Gla)CCSNPACRVNNOHVC
P01511 Gla(1)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) GM(BTr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla)
GSCTM(BTr)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02847 Gla(3)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) LCODYT(Gla)OCSHAH(Gla)CCSWNCYNGHCTG
P01524 Gla-MrII I2 superfamily Conus marmoreus SCDS(Gla)FSS(Gla)FC(Gla)QP(Gla)(Gla)RICSC
STHVCCHLSSSKRDQCMTWNRCLSAQTGN
P02692 Gla-MrIII T superfamily Conus marmoreus FCCRTQ(Gla)VCC(Gla)AIKN(nh2)
P02693 Gla-MrIV T superfamily Conus marmoreus CCITF(Gla)SCC(Gla)FDL
P02625 LtIIIA M superfamily Conus litteratus D(Gla)CC(Gla)OQWCDGACDCCS
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
COOKRKO(nh2)
P03607 Ml20.1 D superfamily Conus miles DVQ(Gla)CQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGKGHGCSC
P03609 Ml20.2 D superfamily Conus miles DVQ(Gla)CQVVTOGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGRGHGCSC
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(BTr)HPTWCPWC(nh2)
P05457 Mr061 O1 superfamily Conus marmoreus CIDGG(Gla)ICDIFFQTAAVGGALFSSAH(Gla)TTVMSS
TPLCATWLDL
P05459 Mr062 O1 superfamily Conus marmoreus CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC
AT(BTr)LDL
P05398 Mr12.10 I2 superfamily Conus marmoreus SCDS(Gla)FSS(Gla)FC(Gla)QP(Gla)ERICSCSTHV
CCHLSSRQKGSQCTTWNRCLSAQTGN
P05400 Mr12.11 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)(Gla)TCFCPNHMC
CPLSPYRQDQCMYW(Gla)ACLIF
P05402 Mr12.12 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)(Gla)TCFCPNHMC
CPLSPYRQDQCMYW(Gla)ACHIF
P05405 Mr12.13 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)(Gla)TCFCPNHMC
CPLSPYRQDQCMYW(Gla)ACHTF
P05395 Mr12.9 I2 superfamily Conus marmoreus SCDS(Gla)FSS(Gla)FC(Gla)QP(Gla)(Gla)RICSC
STHVCCHLSSRKRDQCMTWNRCLSAQTGN
P05411 Mr14.6 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE
SIQTGSVYVLEACRIFTKTS(nh2)
P05489 Mr15.2 N superfamily Conus marmoreus CRSGKTCORVGODVCC(Gla)RSDCFCKLVOARPFWRYRCI
CL
P02690 Mr5.1a T superfamily Conus marmoreus CCPGWELCC(Gla)WDEW
P02691 Mr5.1b T superfamily Conus marmoreus CCPGWELCC(Gla)WDDGW
P02694 Mr5.4a T superfamily Conus marmoreus CCQVMPQCC(Gla)WN
P02695 Mr5.4b T superfamily Conus marmoreus CCQIVPQCC(Gla)WN
P05471 Mr5.8 T superfamily Conus marmoreus CCQIVPQCC(Gla)WVSD
P05376 Mr6.29 O2 superfamily Conus marmoreus ZC(Gla)DV(BTr)MPCTSSHW(Gla)CCSLDCEMYCTQI
P03597 Ms20.1 D superfamily Conus mustelinus DVR(Gla)CNINTOGSSWGKCCLTRMCGPMCCARSGCTCVY
HWRRGHGCSCPG
P03599 Ms20.2 D superfamily Conus mustelinus DVR(Gla)CNINTOGSSWGKCCLTRMCGTMCCARSGCTCVY
HWRRGHGCSCPG
P03601 Ms20.3 D superfamily Conus mustelinus DVR(Gla)CQVNTOGSSWGKCCMTRMCGTMCCARSGCTCVY
HWRRGHGCSCPG
P03603 Ms20.4 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCMTRMCGTMCCARSGCTCV
YHWRRGHGCSCPG
P03605 Ms20.5 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCLTRMCGPMCCARSGCTCV
YHWRRGHGCSCPG
P01636 PnVIIA O2 superfamily Conus pennaceus DCTSWFGRCTVNS(Gla)CCSNSCDQTYC(Gla)LYAFOS
P03615 Rt20.1 D superfamily Conus rattus DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCVY
HRRRGHGCSC
P03617 Rt20.2 D superfamily Conus rattus DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCIY
HRRRGHGCSC
P02589 RVIIA O1 superfamily Conus radiatus (BTr)FGH(Gla)(Gla)CTY(BTr)LGPC(Gla)VDDTCC
SASC(Gla)SKFCGL(BTr)
P01574 RVIIIA S superfamily Conus radiatus KCNFDKCKGTGVYNCG(Gla)SCSC(Gla)GLHSCRCTYNI
GSMKSGCACICTYY
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
(BTr)VDP(nh2)
P02482 Scratcher peptide Conus geographus (Geography cone) KFLSGGFK(Gla)IVCHRYCAKGIAKEFCNCPD(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P02802 SrXIA I2 superfamily Conus spurius CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2)
P05829 Tx5.4 Conus textile (Cloth-of-gold cone) NCCPID(Gla)ESCCS
P02559 TxIXA P superfamily Conus textile (Cloth-of-gold cone) GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2)
P01543 TxVA T superfamily Conus textile (Cloth-of-gold cone) (Gla)CC(Gla)DG(BTr)CC(gTr)AAO
P01517 TxVIIA O2 superfamily Conus textile (Cloth-of-gold cone) CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2)
P02551 TxX I2 superfamily Conus textile (Cloth-of-gold cone) SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS
THTCCHWARRDQCMKPQRCISAQKGN(nh2)
P02552 TxXI I2 superfamily Conus textile (Cloth-of-gold cone) CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2)
P04467 Vc1.1 [E14Gla] synthetic construct GCCSDPRCNYDHP(Gla)IC(nh2)
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02542 VcVC T superfamily Conus victoriae ICCYPN(Gla)(BTr)CCD
P03619 Vt20.1 D superfamily Conus vitulinus DD(Gla)S(Gla)CIINTRDSPWGRCCRTRMCGSMCCPRNG
CTCVYHWRRGHGCSCPG
P01685 VxXXB D superfamily Conus vexillum DD(Gla)S(Gla)CIINTRDSPWGRCCRTRMCGSMCCPRNG
CTCVYHWRRGHGCSCPG