Protein List

Your search: PTM in [Gamma carboxylic glutamic acid]

Found 129 entries.

ID Name Gene superfamily Organism Sequence
P07473 Am6.1 O2 superfamily Conus amadis CDG(Btr)STYCHDDS(Gla)CST(Gla)ANSYCTLIKGV
P01473 AsVIIA O1 superfamily Conus austini TCKQKGEGCSLDV(Gla)CCSSSCKPGGPLFDFDC
P01811 Bromosleeper peptide O3 superfamily Conus radiatus (Btr)ATID(Gla)C(Gla)(Gla)TCNVTFKTCCGOOGDW
P02526 BtX I2 superfamily Conus betulinus CRA(Gla)GTYC(Gla)NDSQCCLN(Gla)CCWGGCGHOCR
P07002 BuIIIB[E3(Gla),C5U,C6A,C17U,C23A] synthetic construct VG(Gla)R(Sec)AKNGKRGCGRW(Sec)RDHSRAC(nh2)
P04921 Cal9.7 Conus californicus TFEPNA(Gla)(Gla)CIVDGRCKHRSDWPC(Gla)MSSGT
P06935 Con-ins G1 A chain Insulin superfamily Conus geographus (Geography cone) GVV(Gla)HCCHRPCSNA(Gla)FKKYC(nh2)
P06934 Con-ins G1 B chain Insulin superfamily Conus geographus (Geography cone) TFDTOKHRCGS(Gla)ITNSYMDLCYR
P06937 Con-ins G3 A chain Insulin superfamily Conus geographus (Geography cone) GIV(Gla)VCCDNOCTVATLRTFCH
P06936 Con-ins G3 B chain Insulin superfamily Conus geographus (Geography cone) NSDTPKHRCGS(Gla)LADQYVQLCH(nh2)
P03691 conantokin-Br [R5−6] synthetic construct GD(Gla)(Gla)VAKFI(Gla)RER(Gla)AGRLDLSKFP
P03689 conantokin-Br [R7−10] synthetic construct GD(Gla)(Gla)YSKMA(Gla)ERE(Gla)EAGRLDLSKFP
P03693 conantokin-Br [Y5V] synthetic construct GD(Gla)(Gla)VSKFI(Gla)RER(Gla)AGRLDLSKFP
P03687 Conantokin-Br/R synthetic construct GD(Gla)(Gla)YSKFI(Gla)LAR(Gla)NIAKGCKVNCY
P03534 Conantokin-E1 B1 superfamily Conus ermineus (Atlantic fish-hunting cone) GE(Gla)(Gla)HSKYQ(Gla)CLR(Gla)IRVNNVQQ(Gla)
P01338 Conantokin-G B1 superfamily Conus geographus (Geography cone) GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN(nh2)
P05699 Conantokin-G[+10Gla,Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Gla)(Buc)LIR(Buc)KS
P07643 conantokin-G[+10O] synthetic construct GE(Gla)(Gla)LQ(Gla)NQO(Gla)LIR(Gla)KSN(nh2)
P05698 Conantokin-G[Gla10Bsc,Gla14Bsc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Bsc)LIR(Bsc)KSN(nh2)
P05697 Conantokin-G[Gla10Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Gla)NQ(Buc)LIR(Buc)KSN(nh2)
P05700 Conantokin-G[Gla7Buc,Gla14Buc] synthetic construct GE(Gla)(Gla)LQ(Huc)NQ(Gla)LIR(Buc)KSN(nh2)
P02637 Conantokin-L B1 superfamily Conus lynceus GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)DAVN(nh2)
P03532 Conantokin-P B1 superfamily Conus purpurascens GE(Gla)(Gla)HSKYQ(Gla)CLR(Gla)IRVNKVQQ(Gla)
P03537 Conantokin-Pr1 Conus parius GED(Gla)YA(Gla)GIR(Gla)YQLIHGKI
P03536 Conantokin-Pr2 Conus parius DEP(Gla)YA(Gla)AIR(Gla)YQLKYGKI
P03535 Conantokin-Pr3 Conus parius GEP(Gla)VAKWA(Gla)GLR(Gla)KAASN(nh2)
P02594 Conantokin-R B1 superfamily Conus radiatus GE(Gla)(Gla)VAKMAA(Gla)LAR(Gla)NIAKGCKVNC
P03692 conantokin-R [Br5−6] synthetic construct GE(Gla)(Gla)YSKMA(Gla)ELA(Gla)ENIAKGCKVNC
P03690 conantokin-R [Br7−9] synthetic construct GE(Gla)(Gla)VAKFI(Gla)LAR(Gla)NIAKGCKVNCY
P03694 conantokin-R [V5Y] synthetic construct GE(Gla)(Gla)YAKMA(Gla)ELARENIAKGCKVNCYP
P03688 Conantokin-R/Br synthetic construct GE(Gla)(Gla)VAKMA(Gla)ERE(Gla)EAGRLDLSKFP
P05842 conantokin-Rl1 B1 superfamily Conus rolani AD(Gla)(Gla)YLKFI(Gla)EQRKQGKLDPTKFP
P05841 Conantokin-Rl2 B1 superfamily Conus rolani GE(Gla)(Gla)LA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05846 conantokin-Rl2[delO10] synthetic construct GE(Gla)(Gla)LA(Gla)KA(Gla)FAR(Gla)LAN(nh2)
P05848 Conantokin-Rl2[K8N,A9Q,del10O] synthetic construct GE(Gla)(Gla)LA(Gla)NQ(Gla)FAR(Gla)LAN(nh2)
P05847 Conantokin-Rl2[K8Nle] synthetic construct GE(Gla)(Gla)LA(Gla)(Nle)AO(Gla)FAR(Gla)LA
P05844 Conantokin-Rl2[L5Y] synthetic construct GE(Gla)(Gla)YA(Gla)KAO(Gla)FAR(Gla)LAN(nh2)
P05845 conantokin-Rl2[O10A] synthetic construct GE(Gla)(Gla)LA(Gla)KAA(Gla)FAR(Gla)LAN(nh2)
P07642 conantokin-Rl2[O10P] synthetic construct GE(Gla)(Gla)LA(Gla)KAP(Gla)FAR(Gla)LAN(nh2)
P05851 Conantokin-Rl3 B1 superfamily Conus rolani GE(Gla)(Gla)LS(Gla)NAV(Gla)FAR(Gla)LAN(nh2)
P03641 Conantokin-Su B1 superfamily Conus sulcatus GD(Gla)(Gla)YSKFI(Gla)RER(Gla)AGRLDLSKFP
P07399 Conantokin-SuA Conus sulcatus GD(Gla)(Gla)YS(Gla)FI(Gla)RER(Gla)LVSSKIP
P07401 Conantokin-SuB Conus sulcatus GE(Gla)(Gla)YS(Gla)AI(nh2)
P07409 Conantokin-SuB deamidated synthetic construct GE(Gla)(Gla)YS(Gla)AI
P07411 Conantokin-SuB[A8F] synthetic construct GE(Gla)(Gla)YS(Gla)FI(nh2)
P07412 Conantokin-SuB[S6A,A8F] synthetic construct GE(Gla)(Gla)YA(Gla)FI
P07403 Conantokin-SuC Conus sulcatus DD(Gla)(Gla)YA(Gla)FI(Gla)QQR(Gla)AGLV
P07413 Conantokin-SuC[A6S,F8A,del10-18] synthetic construct DD(Gla)(Gla)YS(Gla)AI(nh2)
P07410 Conantokin-SuC[del10-18] synthetic construct DD(Gla)(Gla)YA(Gla)FI(nh2)
P07405 Conantokin-SuD Conus sulcatus GK(Gla)(Gla)LA(Gla)NAP(Gla)FAR(Gla)LATN(nh2)
P07407 Conantokin-SuE Conus sulcatus GE(Gla)(Gla)CS(Gla)AI(nh2)
P01269 Conantokin-T Conus tulipa (tulip cone) GE(Gla)(Gla)YQKML(Gla)NLR(Gla)AEVKKNA(nh2)
P08992 Conomarphin Eb2 Conus eburneus GWVYHANP(Gla)ANSWWT
P08925 conomarphin-Ac1[E10(Gla), W14(Gla)] synthetic construct NYYLYOARO(Gla)NSw(Gla)T
P08926 conomarphin-Ac1[E10(Gla), W14(Gla)] amidated synthetic construct NYYLYOARO(Gla)NSw(Gla)T(nh2)
P08924 conomarphin-Ac1[E10(Gla)] synthetic construct NYYLYOARO(Gla)NSwwT
P03538 Conorfamide-Sr2 Conus spurius GPM(Gla)DPL(Gla)IIRI(nh2)
P01268 conotoxin-GS O1 superfamily Conus geographus (Geography cone) ACSGRGSRCOOQCCMGLRCGRGNPQKCIGAH(Gla)DV
P02570 contryphan-M O2 superfamily Conus marmoreus N(Gla)S(Gla)CPwHPWC(nh2)
P03589 Cp20.2 D superfamily Conus capitaneus DVR(Gla)CQVDTPGSSWGKCCMTRMCGTMCCSRSVCTCVY
P03591 Cp20.3 D superfamily Conus capitaneus (Gla)VQ(Gla)CQVDTOGSSWGKCCMTRMCGTMCCSRSVC
P03593 Cp20.4 D superfamily Conus capitaneus ND(Gla)S(Gla)CIISTPGSSWGRCCLTRMCGTMCCPRSG
P03595 Cp20.5 D superfamily Conus capitaneus DNEA(Gla)CQIDTOGSSWGKCCMTRMCGTMCCSRSVCTCV
P03629 De7b Conus delessertii DCIOGG(Gla)NCDVFROYRCCSGYCILLLCA
P01496 DeVIIA O1 superfamily Conus delessertii ACKOKNNLCAIT(Gla)MA(Gla)CCSGFCLIYRCS(nh2)
P07899 Fr3.1 M superfamily Conus frigidus ZQ(Gla)CCDODWCDGACYNCC
P01307 Gamma-conopressin-vil Conus villepinii CLIQDCP(Gla)G(nh2)
P00098 GID A superfamily Conus geographus (Geography cone) IRD(Gla)CCSNPACRVNNOHVC
P04481 GID [R12A] synthetic construct IRD(Gla)CCSNPACAVNNOHVC
P03565 GID[R12A] synthetic construct IRD(Gla)CCSNPACRVNNOHVC
P01511 Gla(1)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) GM(Btr)G(Gla)CKDGLTTCLAOS(Gla)CCS(Gla)DC(Gla)
P02845 Gla(2)-TxVI/A O2 superfamily Conus textile (Cloth-of-gold cone) SCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02846 Gla(2)-TxVI/B O2 superfamily Conus textile (Cloth-of-gold cone) NCSDDWQYC(Gla)SOTDCCSWDCDVVCS(nh2)
P02847 Gla(3)-TxVI O2 superfamily Conus textile (Cloth-of-gold cone) LCODYT(Gla)OCSHAH(Gla)CCSWNCYNGHCTG
P01524 Gla-MrII I2 superfamily Conus marmoreus SCDS(Gla)FSS(Gla)FC(Gla)QP(Gla)(Gla)RICSC
P02692 Gla-MrIII T superfamily Conus marmoreus FCCRTQ(Gla)VCC(Gla)AIKN(nh2)
P02693 Gla-MrIV T superfamily Conus marmoreus CCITF(Gla)SCC(Gla)FDL
P08808 GVIIJ[(Btr)2W,D23(Gla),(Scc)24(Eac)] synthetic construct GWCGDOGATCGKLRLYCCSGFC(Gla)(Eac)YTKTCKDKS
P02625 LtIIIA M superfamily Conus litteratus D(Gla)CC(Gla)OQWCDGACDCCS
P02527 MIVA A superfamily Conus magus (Magus cone) AO(Gla)LVV(gTr)A(gTr)TNCCGYNOMTICOOCMCTYS
P05511 Mr038 M superfamily Conus marmoreus N(Gla)FLTHTFS(Btr)HPTWCPWC(nh2)
P05457 Mr061 O1 superfamily Conus marmoreus CIDGG(Gla)ICDIFFQTAAVGGALFSSAH(Gla)TTVMSS
P05459 Mr062 O1 superfamily Conus marmoreus CLDAG(Gla)MCDLLIQNAAVGGALFSSAHKTTVMSSTOLC
P05398 Mr12.10 I2 superfamily Conus marmoreus SCDS(Gla)FSS(Gla)FC(Gla)QP(Gla)ERICSCSTHV
P05400 Mr12.11 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)(Gla)TCFCPNHMC
P05402 Mr12.12 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)(Gla)TCFCPNHMC
P05405 Mr12.13 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)(Gla)TCFCPNHMC
P05395 Mr12.9 I2 superfamily Conus marmoreus SCDS(Gla)FSS(Gla)FC(Gla)QP(Gla)(Gla)RICSC
P05411 Mr14.6 I2 superfamily Conus marmoreus LCDSYISS(Gla)LC(Gla)HP(Gla)ETCLLPQSYVLSVE
P05489 Mr15.2 N superfamily Conus marmoreus CRSGKTCORVGODVCC(Gla)RSDCFCKLVOARPFWRYRCI
P02690 Mr5.1a T superfamily Conus marmoreus CCPGWELCC(Gla)WDEW
P02691 Mr5.1b T superfamily Conus marmoreus CCPGWELCC(Gla)WDDGW
P02694 Mr5.4a T superfamily Conus marmoreus CCQVMPQCC(Gla)WN
P02695 Mr5.4b T superfamily Conus marmoreus CCQIVPQCC(Gla)WN
P05471 Mr5.8 T superfamily Conus marmoreus CCQIVPQCC(Gla)WVSD
P05376 Mr6.29 O2 superfamily Conus marmoreus ZC(Gla)DV(Btr)MPCTSSHW(Gla)CCSLDCEMYCTQI
P03597 Ms20.1 D superfamily Conus mustelinus DVR(Gla)CNINTOGSSWGKCCLTRMCGPMCCARSGCTCVY
P03599 Ms20.2 D superfamily Conus mustelinus DVR(Gla)CNINTOGSSWGKCCLTRMCGTMCCARSGCTCVY
P03601 Ms20.3 D superfamily Conus mustelinus DVR(Gla)CQVNTOGSSWGKCCMTRMCGTMCCARSGCTCVY
P03603 Ms20.4 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCMTRMCGTMCCARSGCTCV
P03605 Ms20.5 D superfamily Conus mustelinus DNE(Gla)ECQINOPGSSWGKCCLTRMCGPMCCARSGCTCV
P08972 PeIA[E14(Gla)] synthetic construct GCCSHPACSVNHP(Gla)LC(nh2)
P06978 PiVIIA Conus princeps (Prince cone) CDAOTHYCTNYW(Gla)CCSGYC(Gla)HSHCW
P01636 PnVIIA O2 superfamily Conus pennaceus DCTSWFGRCTVNS(Gla)CCSNSCDQTYC(Gla)LYAFOS
P03615 Rt20.1 D superfamily Conus rattus DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCVY
P03617 Rt20.2 D superfamily Conus rattus DAR(Gla)CQVNTOGSRWGKCCLNRMCGPMCCPESHCYCIY
P02589 RVIIA O1 superfamily Conus radiatus (Btr)FGH(Gla)(Gla)CTY(Btr)LGPC(Gla)VDDTCC
P01574 RVIIIA S superfamily Conus radiatus KCNFDKCKGTGVYNCG(Gla)SCSC(Gla)GLHSCRCTYNI
P01478 RXIE I1 superfamily Conus radiatus ECKTNKMSCSLH(Gla)(Gla)CCRFRCCFHGKCQTSVFGC
P02482 Scratcher peptide Conus geographus (Geography cone) KFLSGGFK(Gla)IVCHRYCAKGIAKEFCNCPD(nh2)
P03752 SrIA A superfamily Conus spurius RTCCSROTCRM(Gla)YP(Gla)LCG(nh2)
P03901 SrIB A superfamily Conus spurius RTCCSROTCRMEYP(Gla)LCG(nh2)
P02802 SrXIA I2 superfamily Conus spurius CRTEGMSC(Gla)(Gla)NQQCCWRSCCRGECEAPCRFGP(nh2)
P05829 Tx5.4 Conus textile (Cloth-of-gold cone) NCCPID(Gla)ESCCS
P02559 TxIXA P superfamily Conus textile (Cloth-of-gold cone) GCNNSCQ(Gla)HSDC(Gla)SHCICTFRGCGAVN(nh2)
P01543 TxVA T superfamily Conus textile (Cloth-of-gold cone) (Gla)CC(Gla)DG(Btr)CC(gTr)AAO
P01517 TxVIIA O2 superfamily Conus textile (Cloth-of-gold cone) CGGYSTYC(Gla)VDS(Gla)CCSDNCVRSYCTLF(nh2)
P02551 TxX I2 superfamily Conus textile (Cloth-of-gold cone) SCDS(Gla)FSS(Gla)FC(Gla)RP(Gla)(Gla)SCSCS
P02552 TxXI I2 superfamily Conus textile (Cloth-of-gold cone) CIP(Gla)GSSCSSSGSCCHKSCCRWTCNQPCLIP(nh2)
P04467 Vc1.1 [E14Gla] synthetic construct GCCSDPRCNYDHP(Gla)IC(nh2)
P09010 Vc1.1[D11(Gla)] synthetic construct GCCSDPRCNY(Gla)HPEIC(nh2)
P02539 VcIA A superfamily Conus victoriae GCCSDORCNYDHP(Gla)IC(nh2)
P02542 VcVC T superfamily Conus victoriae ICCYPN(Gla)(Btr)CCD
P03619 Vt20.1 D superfamily Conus vitulinus DD(Gla)S(Gla)CIINTRDSPWGRCCRTRMCGSMCCPRNG
P01685 VxXXB D superfamily Conus vexillum DD(Gla)S(Gla)CIINTRDSPWGRCCRTRMCGSMCCPRNG