Protein List

Your search: PTM in [Glycine]

Found 1 entry.


ID Name Gene superfamily Organism Sequence
P08516 C6.15 O1 superfamily Conus catus ASEGCGGIGAPCRDRRCCPDLRCVDGHVGRACQEYMDY