Protein List

Your search: PTM in [Pyroglutamic acid]

Found 45 entries.


ID Name Gene superfamily Organism Sequence
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(BTr)C(nh2)
P04140 Cal16a Divergent MRCLSIFVLL Conus californicus ZGCVCNANAKFCCGE(nh2)
P04141 Cal9.2a Divergent M---L-LTVA Conus californicus ZDDGFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECVS
EADW
P04142 Cal9.2b Conus californicus ZDDRFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECVS
EADW
P04143 Cal9.2c Divergent M---L-LTVA Conus californicus ZDDRFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECRS
EADW
P04144 Cal9.2d Conus californicus ZDDRFPCNAGNCACLPLDSYSYTCLSPTSSTANCESDECVS
EDDW
P04145 Cal9.2e Conus californicus ZDDRTFPCNSGRCACQPLDSYSYTCQSPSSSTANCKNNVCV
SEADW
P04146 Cal9.2f Divergent M---L-LTVA Conus californicus ZDDRTFPCSSGLCACLPLDSYSYICLSPSSSTANCENDECI
SEDDW
P01690 CnIIIB Conus consors ZGCCGEPNLCFTRWCRNNARCCRQQ
P03834 CnIIIC M superfamily Conus consors ZGCCNGPKGCSSKWCRDHARCC(nh2)
P02618 contulakin-G C superfamily Conus geographus (Geography cone) ZSEEGGSNA(gTr)KKPYIL
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P01691 MIIIA Conus magus (Magus cone) ZGCCNVPNGCSGRWCRDHAQCC(nh2)
P05376 Mr6.29 O2 superfamily Conus marmoreus ZC(Gla)DV(BTr)MPCTSSHW(Gla)CCSLDCEMYCTQI
P06932 MrIA [N1Z] synthetic construct ZGVCCGYKLCHOC
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P02228 PIIIA M superfamily Conus purpurascens ZRLCCGFOKSCRSRQCKOHRCC(nh2)
P04296 PIIIA [G6K] synthetic construct ZRLCCKFOKSCRSRQCKOHRCC(nh2)
P04300 PIIIA [K17A] synthetic construct ZRLCCAFOKSCRSRQCAOHRCC(nh2)
P04301 PIIIA [K17Q] synthetic construct ZRLCCAFOKSCRSRQCQOHRCC(nh2)
P04294 PIIIA [K17R] synthetic construct ZRLCCGFOKSCRSRQCROHRCC(nh2)
P04297 PIIIA [R12A] synthetic construct ZRLCCAFOKSCASRQCKOHRCC(nh2)
P04293 PIIIA [R12K] synthetic construct ZRLCCGFOKSCKSRQCKOHRCC(nh2)
P04298 PIIIA [R12Q] synthetic construct ZRLCCAFOKSCQSRQCKOHRCC(nh2)
P04290 PIIIA [R14A] synthetic construct ZRLCCGFOKSCRSAQCKOHRCC(nh2)
P04292 PIIIA [R14K] synthetic construct ZRLCCGFOKSCRSKQCKOHRCC(nh2)
P04291 PIIIA [R14Q] synthetic construct ZRLCCGFOKSCRSQQCKOHRCC(nh2)
P04302 PIIIA [R20A] synthetic construct ZRLCCAFOKSCRSRQCKOHACC(nh2)
P04295 PIIIA [R2A] synthetic construct ZALCCGFOKSCRSRQCKOHRCC(nh2)
P04299 PIIIA [S13D] synthetic construct ZRLCCAFOKSCRDRQCKOHRCC(nh2)
P02707 SIIIA M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCRDHARCC(nh2)
P05703 SIIIA[C3U,C13U] synthetic construct ZNUCNGGCSSKWURDHARCC(nh2)
P05702 SIIIA[C4U,C19U] synthetic construct ZNCUNGGCSSKWCRDHARUC(nh2)
P05704 SIIIA[C8U,C20U] synthetic construct ZNCCNGGUSSKWCRDHARCU(nh2)
P01615 SIIIB M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCKGHARCC(nh2)
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02525 SIVB A superfamily Conus striatus (Striated cone) ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO
(nh2)
P01662 SmIIIA M superfamily Conus stercusmuscarum ZRCCNGRRGCSSRWCRDHSRCC
P02530 SmIVA A superfamily Conus stercusmuscarum ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK
OKKS(nh2)
P02529 SmIVB A superfamily Conus stercusmuscarum ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK
OKKS(nh2)
P03585 SxIIIB M superfamily Conus striolatus ZKCCTGKKGSCSGRACKNLRCCA(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P02788 Vi1361 Conus virgo ZCCPTMPECCRI(nh2)
P01672 ViVA T superfamily Conus virgo ZCCITIPECCRI(nh2)
P01671 ViVB T superfamily Conus virgo ZCCPTIPECCRV(nh2)