Protein List

Your search: PTM in [Pyroglutamic acid]

Found 119 entries.


ID Name Gene superfamily Organism Sequence
P03552 Bromoheptapeptide Im Conus imperialis ZCGQA(Btr)C(nh2)
P08522 C8.2 S superfamily Conus catus ZYPLGCPGTCGKGGKCVGTCECTNYTNCYCGKGFRQPGCSC
TCPT
P08523 C8.4 S superfamily Conus catus ZYPLGCOGTCGKGGKCVGTCECTNYTNCYCSSKGFREPGCS
CTCPT
P04140 Cal16.1 Divergent MRCLSIFVLL Conus californicus ZGCVCNANAKFCCGE(nh2)
P04141 Cal9.2a Divergent M---L-LTVA Conus californicus ZDDGFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECVS
EADW
P04142 Cal9.2b Conus californicus ZDDRFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECVS
EADW
P04143 Cal9.2c Divergent M---L-LTVA Conus californicus ZDDRFPCNAGNCACLPLDSYSYTCQSPTSSTANCEGNECRS
EADW
P04144 Cal9.2d Conus californicus ZDDRFPCNAGNCACLPLDSYSYTCLSPTSSTANCESDECVS
EDDW
P04145 Cal9.2e Conus californicus ZDDRTFPCNSGRCACQPLDSYSYTCQSPSSSTANCKNNVCV
SEADW
P04146 Cal9.2f Divergent M---L-LTVA Conus californicus ZDDRTFPCSSGLCACLPLDSYSYICLSPSSSTANCENDECI
SEDDW
P01690 CnIIIB Conus consors ZGCCGEPNLCFTRWCRNNARCCRQQ
P03834 CnIIIC M superfamily Conus consors ZGCCNGPKGCSSKWCRDHARCC(nh2)
P02618 contulakin-G C superfamily Conus geographus (Geography cone) ZSEEGGSNA(gTr)KKPYIL
P04069 EIIA A superfamily Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWNPACVKNRC(nh2)
P07538 EIIB Conus ermineus (Atlantic fish-hunting cone) ZTOGCCWHPACGKNRC(nh2)
P07899 Fr3.1 M superfamily Conus frigidus ZQ(Gla)CCDODWCDGACYNCC
P01691 MIIIA Conus magus (Magus cone) ZGCCNVPNGCSGRWCRDHAQCC(nh2)
P05376 Mr6.29 O2 superfamily Conus marmoreus ZC(Gla)DV(Btr)MPCTSSHW(Gla)CCSLDCEMYCTQI
P07635 MrIA [N1Z, C10c] synthetic construct ZGVCCGYKLcHOC(nh2)
P07637 MrIA [N1Z, C13c] synthetic construct ZGVCCGYKLCHOc(nh2)
P07639 MrIA [N1Z, C4(Hcy), C5(Hcy), C10(Hcy), C13(Hcy)] synthetic construct ZGVXXGYKLXHOX(nh2)
P07636 MrIA [N1Z, C4c, C13c] synthetic construct ZGVcCGYKLCHOc(nh2)
P07633 MrIA [N1Z, C4c, C5c, C10c, C13c] synthetic construct ZGVccGYKLcHOc(nh2)
P07638 MrIA [N1Z, C4c] synthetic construct ZGVcCGYKLCHOC(nh2)
P07634 MrIA [N1Z, C5c, C10c] synthetic construct ZGVCcGYKLcHOC(nh2)
P07640 MrIA [N1Z, Y7(Mty), H11W] synthetic construct ZGVCCG(Mty)KLCWOC(nh2)
P07641 MrIA [N1Z, Y7(Mty), L9(Cha), H11W] synthetic construct ZGVCCG(Mty)K(Cha)CWOC(nh2)
P08709 MrIA [N1Z,del10-13] synthetic construct ZGVCCGYKL
P08707 MrIA [N1Z,del11-13] synthetic construct ZGVCCGYKLC
P07621 MrIA [N1Z,H11(Bta)] synthetic construct ZGVCCGYKLC(BTA)OC(nh2)
P07616 MrIA [N1Z,H11(Fla)] synthetic construct ZGVCCGYKLC(FLA)OC(nh2)
P07620 MrIA [N1Z,H11(Nal)] synthetic construct ZGVCCGYKLC(Nal)OC(nh2)
P07617 MrIA [N1Z,H11(Pya)] synthetic construct ZGVCCGYKLC(PYA)OC(nh2)
P07625 MrIA [N1Z,H11E] synthetic construct ZGVCCGYKLCEOC(nh2)
P07615 MrIA [N1Z,H11F] synthetic construct ZGVCCGYKLCFOC(nh2)
P07622 MrIA [N1Z,H11h] synthetic construct ZGVCCGYKLChOC(nh2)
P07624 MrIA [N1Z,H11L] synthetic construct ZGVCCGYKLCLOC(nh2)
P07623 MrIA [N1Z,H11P] synthetic construct ZGVCCGYKLCPOC(nh2)
P07626 MrIA [N1Z,H11Q] synthetic construct ZGVCCGYKLCQOC(nh2)
P07614 MrIA [N1Z,H11R] synthetic construct ZGVCCGYKLCROC(nh2)
P07619 MrIA [N1Z,H11W] synthetic construct ZGVCCGYKLCWOC(nh2)
P07618 MrIA [N1Z,H11Y] synthetic construct ZGVCCGYKLCYOC(nh2)
P07603 MrIA [N1Z,K8(Cit)] synthetic construct ZGVCCGY(Cit)LCHOC(nh2)
P07596 MrIA [N1Z,K8(Hly)] synthetic construct ZGVCCGY(HLY)LCHOC(nh2)
P07602 MrIA [N1Z,K8(Nle)] synthetic construct ZGVCCGY(Nle)LCHOC(nh2)
P07595 MrIA [N1Z,K8(Orn)] synthetic construct ZGVCCGY(Orn)LCHOC(nh2)
P07601 MrIA [N1Z,K8E] synthetic construct ZGVCCGYELCHOC(nh2)
P07600 MrIA [N1Z,K8I] synthetic construct ZGVCCGYILCHOC(nh2)
P07594 MrIA [N1Z,K8k] synthetic construct ZGVCCGYkLCHOC(nh2)
P07599 MrIA [N1Z,K8L] synthetic construct ZGVCCGYLLCHOC(nh2)
P07598 MrIA [N1Z,K8Q] synthetic construct ZGVCCGYQLCHOC(nh2)
P07597 MrIA [N1Z,K8R] synthetic construct ZGVCCGYRLCHOC(nh2)
P07604 MrIA [N1Z,K8W] synthetic construct ZGVCCGYWLCHOC(nh2)
P07608 MrIA [N1Z,L9(Cha)] synthetic construct ZGVCCGYKXCHOC(nh2)
P07607 MrIA [N1Z,L9(Hle)] synthetic construct ZGVCCGYK(HLE)CHOC(nh2)
P07606 MrIA [N1Z,L9(Nle)] synthetic construct ZGVCCGYK(Nle)CHOC(nh2)
P07610 MrIA [N1Z,L9I] synthetic construct ZGVCCGYKICHOC(nh2)
P07611 MrIA [N1Z,L9P] synthetic construct ZGVCCGYKPCHOC(nh2)
P07609 MrIA [N1Z,L9Q] synthetic construct ZGVCCGYKQCHOC(nh2)
P07612 MrIA [N1Z,L9R] synthetic construct ZGVCCGYKRCHOC(nh2)
P07613 MrIA [N1Z,L9S] synthetic construct ZGVCCGYKSCHOC(nh2)
P07605 MrIA [N1Z,L9V] synthetic construct ZGVCCGYKVCHOC(nh2)
P07630 MrIA [N1Z,O12(Mey)] synthetic construct ZGVCCGYKLCH(Mty)C(nh2)
P07628 MrIA [N1Z,O12(Tic)] synthetic construct ZGVCCGYKLCH(Tic)C(nh2)
P07631 MrIA [N1Z,O12D] synthetic construct ZGVCCGYKLCHDC(nh2)
P07632 MrIA [N1Z,O12E] synthetic construct ZGVCCGYKLCHEC(nh2)
P07627 MrIA [N1Z,O12K] synthetic construct ZGVCCGYKLCHKC(nh2)
P08706 MrIA [N1Z,O12P,del13] synthetic construct ZGVCCGYKLCHP
P08705 MrIA [N1Z,O12P] synthetic construct ZGVCCGYKLCHPC
P07629 MrIA [N1Z,O12Y] synthetic construct ZGVCCGYKLCHYC(nh2)
P07582 MrIA [N1Z,Y7(Cha)] synthetic construct ZGVCCG(Cha)KLCHOC(nh2)
P07577 MrIA [N1Z,Y7(Dmk)] synthetic construct ZGVCCG(DMF)KLCHOC(nh2)
P07578 MrIA [N1Z,Y7(Dpa)] synthetic construct ZGVCCG(DPA)KLCHOC(nh2)
P07579 MrIA [N1Z,Y7(Hly)] synthetic construct ZGVCCG(HLY)KLCHOC(nh2)
P07581 MrIA [N1Z,Y7(Mty)] synthetic construct ZGVCCG(Mty)KLCHOC(nh2)
P07593 MrIA [N1Z,Y7(Thi)] synthetic construct ZGVCCG(THI)KLCHOC(nh2)
P07584 MrIA [N1Z,Y7E] synthetic construct ZGVCCGEKLCHOC(nh2)
P07580 MrIA [N1Z,Y7F] synthetic construct ZGVCCGFKLCHOC(nh2)
P07585 MrIA [N1Z,Y7I] synthetic construct ZGVCCGIKLCHOC(nh2)
P07586 MrIA [N1Z,Y7K] synthetic construct ZGVCCGKKLCHOC(nh2)
P07587 MrIA [N1Z,Y7L] synthetic construct ZGVCCGLKLCHOC(nh2)
P07588 MrIA [N1Z,Y7P] synthetic construct ZGVCCGPKLCHOC(nh2)
P07589 MrIA [N1Z,Y7Q] synthetic construct ZGVCCGQKLCHOC(nh2)
P07590 MrIA [N1Z,Y7R] synthetic construct ZGVCCGRKLCHOC(nh2)
P07591 MrIA [N1Z,Y7S] synthetic construct ZGVCCGSKLCHOC(nh2)
P07583 MrIA [N1Z,Y7W] synthetic construct ZGVCCGWKLCHOC(nh2)
P07592 MrIA [N1Z,Y7y] synthetic construct ZGVCCGyKLCHOC(nh2)
P06932 MrIA [N1Z] synthetic construct ZGVCCGYKLCHOC(nh2)
P08710 MrIA amidated [N1Z,del10-13] synthetic construct ZGVCCGYKL(nh2)
P00038 PIB A superfamily Conus purpurascens ZSOGCCWNPACVKNRC(nh2)
P02228 PIIIA M superfamily Conus purpurascens ZRLCCGFOKSCRSRQCKOHRCC(nh2)
P04296 PIIIA [G6K] synthetic construct ZRLCCKFOKSCRSRQCKOHRCC(nh2)
P04300 PIIIA [K17A] synthetic construct ZRLCCAFOKSCRSRQCAOHRCC(nh2)
P04301 PIIIA [K17Q] synthetic construct ZRLCCAFOKSCRSRQCQOHRCC(nh2)
P04294 PIIIA [K17R] synthetic construct ZRLCCGFOKSCRSRQCROHRCC(nh2)
P04297 PIIIA [R12A] synthetic construct ZRLCCAFOKSCASRQCKOHRCC(nh2)
P04293 PIIIA [R12K] synthetic construct ZRLCCGFOKSCKSRQCKOHRCC(nh2)
P04298 PIIIA [R12Q] synthetic construct ZRLCCAFOKSCQSRQCKOHRCC(nh2)
P04290 PIIIA [R14A] synthetic construct ZRLCCGFOKSCRSAQCKOHRCC(nh2)
P04292 PIIIA [R14K] synthetic construct ZRLCCGFOKSCRSKQCKOHRCC(nh2)
P04291 PIIIA [R14Q] synthetic construct ZRLCCGFOKSCRSQQCKOHRCC(nh2)
P04302 PIIIA [R20A] synthetic construct ZRLCCAFOKSCRSRQCKOHACC(nh2)
P04295 PIIIA [R2A] synthetic construct ZALCCGFOKSCRSRQCKOHRCC(nh2)
P04299 PIIIA [S13D] synthetic construct ZRLCCAFOKSCRDRQCKOHRCC(nh2)
P02707 SIIIA M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCRDHARCC(nh2)
P05703 SIIIA[C3U,C13U] synthetic construct ZNUCNGGCSSKWURDHARCC(nh2)
P05702 SIIIA[C4U,C19U] synthetic construct ZNCUNGGCSSKWCRDHARUC(nh2)
P05704 SIIIA[C8U,C20U] synthetic construct ZNCCNGGUSSKWCRDHARCU(nh2)
P01615 SIIIB M superfamily Conus striatus (Striated cone) ZNCCNGGCSSKWCKGHARCC(nh2)
P02524 SIVA A superfamily Conus striatus (Striated cone) ZKSLVP(gSr)VITTCCGYDOGTMCOOCRCTNSC(nh2)
P02525 SIVB A superfamily Conus striatus (Striated cone) ZKELVP(gSr)VITTCCGYDOGTMCOOCRCTNSCOTKOKKO
(nh2)
P01662 SmIIIA M superfamily Conus stercusmuscarum ZRCCNGRRGCSSRWCRDHSRCC
P02530 SmIVA A superfamily Conus stercusmuscarum ZTWLVP(gSr)(gTr)ITTCCGYDOGTMCOTCMCDNTCKOK
OKKS(nh2)
P02529 SmIVB A superfamily Conus stercusmuscarum ZPWLVP(gSr)(gTr)ITTCCGYDOGSMCOOCMCNNTCKOK
OKKS(nh2)
P03585 SxIIIB M superfamily Conus striolatus ZKCCTGKKGSCSGRACKNLRCCA(nh2)
P03754 Tx10c Conus textile (Cloth-of-gold cone) ZTCCGYRMCVOC(nh2)
P02788 Vi1361 Conus virgo ZCCPTMPECCRI(nh2)
P01672 ViVA T superfamily Conus virgo ZCCITIPECCRI(nh2)
P01671 ViVB T superfamily Conus virgo ZCCPTIPECCRV(nh2)