Protein List

Your search: Gene superfamily in [A superfamily] and Protein Type in [Precursor]

Found 276 entries.


ID Name Gene superfamily Organism Sequence
P03917 A4.1 precursor A superfamily Conus aurisiacus
MFTVFLLVVLATTVVS
IPSDRASDGRNAAVNER
APWLVPST
ITTCCGYNPGTMCPPCRCDNTC
P03920 A4.2 precursor A superfamily Conus aurisiacus
MFTVFLLVVLATTVVS
IPSDRASDGRNAAVNER
QSWLVPST
ITTCCGYDPGTMCPPCRCNNTCKPKKPKPGK
GRRND
P00570 Ac1.1a precursor A superfamily Conus achatinus
MGMRMMFTLFLLVVLTTTVVS
YPSDSASDGRDDEAKDERSD
MYELKR
NGRCCHPACGKHFNC
GR
P00562 Ac1.1a precursor A superfamily Conus achatinus SDGRDDEAIDERSDMYELKR
NGRCCHPACGKHFNC
GR
P00571 Ac1.1b precursor A superfamily Conus achatinus
MGMRMMFTLFLLVVLTTTVVS
FPSDSASDGRDDEAKDERSD
MYKSKR
NGRCCHPACGKHFSC
GR
P00545 Ac1.1b precursor A superfamily Conus achatinus
MGMRMMFTVFLLVVLTTTVVSYPS
DSASDGRDDEAKDERSD
MYESKR
NGRCCHPACGKHFSC
GR
P02989 Ac1.1b precursor A superfamily Conus achatinus
MFTVFLLVVLTTTVVS
YPSDSASDGRDDEAKDERSDMYKSK
R
NGRCCHPACGKHFSC
GR
P02987 Ac1.2 precursor A superfamily Conus achatinus
MFTVFLLVVLTTTVVS
FPSDSASGGRDDEAKDERSDMYELK
R
NGRCCHPACGGKYVKC
GR
P03914 Ac4.1 precursor A superfamily Conus achatinus
MFTVFLLVVLATTLVSIP
SDRASDFRNAAVHER
QKELVVTA
TTTCCGYNPMTSCPRCMCDSSCNKKKP
GRRND
P03915 Ac4.2 precursor A superfamily Conus achatinus
MFTVFLLVVLATTLVS
IPSDRASDGRNAVVHER
QPWLVPSK
ITNCCGYNNMEMCPTCMCTYSCRP
KKKKPGHRND
P00563 Ac4.2 precursor A superfamily Conus achatinus FDGRNAAVNER
APWMVVTATTNCCGYTGPACHPCLCTQSC
G
P00564 Ac4.3a precursor A superfamily Conus achatinus SDFRNAAVHER
QKELVVTATTTCCGYNPMTSCPRCMCDSSC
NKKKK
PGRRND
P00565 Ac4.3b precursor A superfamily Conus achatinus SDVRNAAVHER
QKELVPSKITTCCGYSPGTACPSCMCTNTC
KKKNKKP
GRRND
P02943 Ai1.1 precursor A superfamily Conus ammiralis
MFTVFLLVVLATTVVS
FTSDRAFRGRNAAAKASGLVGLTDK
R
QECCSYPACNLDHPELC
G
P02945 Ai1.2 precursor A superfamily Conus ammiralis
MFTVFLLVVLATTVVSS
TSGRRAFRGRNAAAKASGLVGLTD
RR
PECCSDPRCNSTHPELCG
GRR
P02838 ArIA precursor A superfamily Conus arenatus SDGRNVAAKAFHRIGRT
IRDECCSNPACRVNNPHVCRRR
P02878 AuIA precursor A superfamily Conus aulicus
MFTVFLLVVLATTVVS
FTSDRASDGRKDAASGLIALTIK
GC
CSYPPCFATNSDYC
G
P02879 AuIB precursor A superfamily Conus aulicus
MFTVFLLVVLATTVVS
FTSDRASDGRKDAASGLIALTMK
GC
CSYPPCFATNPDC
GRRR
P00019 Bn1.1 precursor A superfamily Conus bandanus
MGMRMMFTMFLLVVLATTVVS
FASDRASDGRNAAAKDKASD
LVALTVK
GCCSHPACSVNNPDIC
G
P00020 Bn1.3 precursor A superfamily Conus bandanus
MGMRMMFTVFLLVVLATA
VLPVTLDRASDGRNAAANAKTPR
LIAPFIR
DYCCHRGPCMVWC
G
P02906 Bt1.1 precursor A superfamily Conus betulinus
MFSVFLLVVLATTVVSSTSG
GASGGRKAAAKASNRIALTVR
SATCCNYPPCYETYPESCL
P02908 Bt1.2 precursor A superfamily Conus betulinus
MFTVFLLVVLATTVVSFTSG
RAFRGRNRAADDKRSDLAALS
VR
GGCCSHPACAVNHPELC
G
P02910 Bt1.3 precursor A superfamily Conus betulinus
MFTVFLLVVLATTVVSFTSG
RASGGRNAAAKASNR
IAMAIS
SGACCAYPPCFEAYPERCL
P02912 Bt1.4 precursor A superfamily Conus betulinus
MFTVFLLVVLATTVVS
FTSDRAFRGRNSAANDKRSDLAALS
VRR
GCCSHPACSVNHPELC
GRRR
P02914 Bt1.5 precursor A superfamily Conus betulinus
MFTVFLLVVLATTVVSFTSG
RASGGRNAAAKASNRIALIVR
NAECCYYPPCYEAYPEICL
P02991 Bt1.6 precursor A superfamily Conus betulinus
MFTVFLLVVLATTVVS
YPSDSASDGRDDETKDEKSDMYKSK
R
NGRCCHPACGKHFSC
GR
P04563 Bt1.61 precursor A superfamily Conus betulinus
MGMRMMFTVFLLVVLATTVV
SFTSDRASDGRNAAGNEMPDW
VIR
AIKLTCCSELTCAGNYPNIC
G
P06142 Bt1.7 precursor A superfamily Conus betulinus
MGMRMMFIVFLLVVLATTVVS
FTSDRASDGGNAAAKASDLI
AQTIR
GGCCSYPACSVEHQDLCD
GRR
P04564 Bt1.91 precursor A superfamily Conus betulinus
MGMRMMFTVFLLVVLATTVV
SLTLDRASGGRRSGADNMIAL
LIIR
KCCSNPACNRYNPAICD
P02931 Bu1.1 precursor A superfamily Conus bullatus
MGMRMMFTVFLLVVLA
TTVVSFSTDDESDGSNEEPSADQTA
R
SSMNRAPGCCNNPAC
VKHRCG
P02933 Bu1.2 precursor A superfamily Conus bullatus
MFTVFLLVVLATTVVS
FSTDDESDGSNEEPSADQAARSAMN
R
PPGCCNNPACVKHRCG
G
P02935 Bu1.3 precursor A superfamily Conus bullatus
MFTVFLLVVLATTVVS
FPSDRDSDGADAEASDEPVEFER
DE
NGCCWNPSCPRPRCT
GRR
P04576 Bu1.3 precursor A superfamily Conus bullatus
MGMRMRMMFTVFLLVVLANTVVS
FPSDRDSDGADAEASDEP
VEFER
DENGCCWNPSCPRPRCT
GRR
P04574 Bu19 precursor A superfamily Conus bullatus
MGMRMVFTVFLLVVLATTVVS
FTSDRASDGRNAAANDKASD
LAALAVR
GCCHDIFCKHNNPDIC
G
P04581 Bu23 precursor A superfamily Conus bullatus
MGMRMMVTVFLLGVLATTVVS
LRSNRASDGRRGIVNK
LNDL
VPQYWTECCGRIGPHCSRCICPEVVCPKN
G
P04583 Bu24 precursor A superfamily Conus bullatus
MGMRMMVTVFLLVVLATTVVS
LRSNRASDGRRGIVNKLNDL
VPK
YWTECCGRIGPHCSRCICPEVACPKN
G
P04585 Bu25 precursor A superfamily Conus bullatus
MGMRMMVTVFPLVVLATTVVS
LRSNRASDGRRGIVNKLNDL
VPK
YWTECCGRIGPHCSRCICPGVVCPKR
G
P00409 BuIA precursor A superfamily Conus bullatus
MFTVFLLVVLTTTVVS
FPSDRASDGRNAAANDKASDVVTLV
LK
GCCSTPPCAVLYC
GRRR
P03923 C4.1 precursor A superfamily Conus catus
MFTVFLLVGLATTLVSIPSDG
ASDGKNAAVHER
QKELVPST
ITTCCGNEPGTMCPKCMCDNTCPPKKKKRP
GRRND
P03925 C4.1b precursor A superfamily Conus catus
MFTVFLLVGLATTLVSIPSDG
ASDGKNAAVHER
QKELVPST
ITTCCGHEPGTMCPKCMCDNTCPPKKKKRP
GRRND
P03924 C4.2 precursor A superfamily Conus catus
MFTVFLLVVLATTVVS
IPSDRASDVRNAAVHER
QKELVVTA
TTTCCGYNPMSMCPKCMCTYSCPHQKKKRP
GRRND
P03926 C4.3 precursor A superfamily Conus catus
MFTVFLLVVLTITVVS
FPSDRASDGRDDEAKDERSDMYKSK
R
NGRCCHPACGKHFSC
GR
P00011 Ca1.1 precursor A superfamily Conus caracteristicus
MGMRMMFTVFLLVVLATTVVS
FTSDRASDGRNAAANAFDLI
ALIAR
QNCCSIPSCWEKYKCS
P00013 Ca1.2 precursor A superfamily Conus caracteristicus
MGMRMMFTVFLLVVLATTVVS
FTSDRASEGRNAAAKDKASD
LVALTVR
GCCAIRECRLQNAAYCGGIY
P06042 Ca1.3 precursor A superfamily Conus caracteristicus
MGMRMMFTVFLLVALATTVVP
FTSDRASASRNAATDNKASE
LKALNAR
IPCCSYPACAQSNIDLCG
GRR
P06043 Ca1.4 precursor A superfamily Conus caracteristicus
MGMRMMFTVFLLVVLATTVLS
FTSDRASEGRNAAAKDKASD
LVALRVR
GCCAIHECRLQNAAYCGGIY
P06144 Ca1.5 precursor A superfamily Conus caracteristicus
MGMRMMFIVFLLVVLATTVVS
FTSDRTSDSRNAAANAFDLI
AR
YLGIDCCRIPSCFAKYGSKCSKI
R
P06044 Ca1.5 precursor A superfamily Conus caracteristicus
MGMRMMFTVFLLVVLATTVVS
FTSDRTSDSRNAAANAFDLI
AR
YLGIDCCRIPSCFAKYGSKCSKI
R
P06045 Ca1.5 precursor A superfamily Conus caracteristicus
MGMRMMFTVFLLVVLATTVVS
FTSDRSPASDSRNAAANAFD
LIAR
YLGIDCCRIPSCFAKYGSKCSKI
R
P06143 Ca1.7 precursor A superfamily Conus caracteristicus
MGMRMMFIVFLLVVLATTVVS
FASDRTSDGRNAAANAFDLI
AR
SFTINCCKIPSCFAKYGSKCSEVH
P06154 CcTx precursor A superfamily Conus consors
MGMRMMFTVFLLVVLATTVVS
IPSDRASDGRNAAVHER
APW
LVPSQITTCCGYNPGTMCPSCMCTNTC
P02922 Ci1.1 precursor A superfamily Conus circumcisus (circumcision cone)
MFTVFLLVVLATTVVS
FPSDRASDGRNAAASDR
ASDAAHQG
CCSNPVCHVEHPELC
RRRR
P02924 Ci1.2 precursor A superfamily Conus circumcisus (circumcision cone)
MFTVFLLVVLATTVVS
FPSNRESDGANAEVR
TDEPEEHDEL
GGNGCCGNPDCTSHSCD
P02995 Ci1.3 precursor A superfamily Conus circumcisus (circumcision cone)
MFTVFLLVVLAATVVS
FPSDRASDGRDDEAKDERSDMHESD
RKGR
GRCCHPACGPNYSC
GR
P02939 Cn1.2 precursor A superfamily Conus consors
MFTVFLLVVLATTVVS
FPSDRASDGRNAAANDKASDVITLA
LK
GCCSNPVCHLEHSNLC
GRRR
P03937 Cn4.1 precursor A superfamily Conus consors
MFTVFLLVVLATTVVS
IPSDRASDGRNAAVHER
APWLVPSQ
ITTCCGYNPGTMCPSCMCTNSC
P03938 Cn4.2 precursor A superfamily Conus consors
MFTVFLLVVLATTVVS
IPSDRASDVRNAAVHER
QKDLVVTA
TTTCCGYNPMTICPPCMCTYSCPPKKKKP
GRRND
P03939 Cn4.3 precursor A superfamily Conus consors
MFTVFLLVVLATTVVS
IPSDRASEGRNAVVHER
APELVVTA
TTTCCGYDPMTICPPCMCTHSCPPKRKP
GRRND
P03940 Cn4.4 precursor A superfamily Conus consors
MFTVFLLVVLATTVVS
IPSDRASDGRNAVVHER
APELVVTA
TTTCCGYDPMTWCPSCMCTYSCPHQRKKP
GRRND
P05532 CnIA/B/K precursor A superfamily Conus consors
MGMRMMFTVFLLVVLTTTVVS
FPSDSASDGRDDEAKDERSD
IYESKR
N
GR
CCHPACGKYYSC
GR
P05244 CnIA/B/L precursor A superfamily Conus consors
MGMRMMFTVFLLVVLTTTVVS
FPSDSASDGRDDEAKDERSD
IYESKR
D
GR
CCHPACGKYYSC
GR
P05542 CnIC/F/H precursor A superfamily Conus consors
MGMRMMFTVFLLVVLTTTVVS
FPSDSASDGRDDEAKDERSD
MYKSKR
N
GR
CCHPACGKHFSC
GR
P05533 CnIC/F/H precursor A superfamily Conus consors
MGMRMMFTVFLLVVLTTTVVS
FPSDSASDVRDDEAKDERSD
MYKSKR
N
GR
CCHPACGKHFSC
GR
P05241 CnID precursor A superfamily Conus consors
MGMRMMFTVFLLVVLTTTVVS
FPSDSASDGRDDEAKDERSD
MYELKRNGR
CCHPACGKHFNC
GR
P05242 CnIE/J precursor A superfamily Conus consors
MMFTVFLLVVLTTTVVS
FPSDSASDGRDDEAKDERSDMYEL
KRN
GR
CCHPACGGKYFKC
GR
P02902 CnIH precursor A superfamily Conus consors
MFTVFLLVVLTTTVVS
FPSDSASDVRDDEAKDERSDMYKSK
R
NGRCCHPACGKHFSC
GR
P03711 CnIH precursor A superfamily Conus consors
MFTVGLLVVLTTTVVS
FPSDSASDVRDDEAKDERSDMYKSK
R
NGRCCHPACGKHFSC
GR
P03933 CnIJ precursor A superfamily Conus consors
MFTVFLLVVLTTTVVS
FPSDRASDGRDDEAKDERSDMYKSK
RN
GRCCHPACGGKYFKC
GR
P06026 Co1.1 precursor A superfamily Conus coronatus
MGMRMMSTVFLLVVLATAVVS
FTLDRASDGGDAAAKAFDLM
ALTAR
LDCCDIHACWSAHPELCG
GRR
P06027 Co1.2 precursor A superfamily Conus coronatus
MGMRMMFTVFLLVVLATAVVS
STSDRASDGRNTASKVFDLI
ALTAR
EDCCFIDDCWASHPEACGGGMELLRQDPLNRDMPPS
A
P06028 Co1.3 precursor A superfamily Conus coronatus
MGMRMMFTVFLLVVLATSVVS
FNSDRASHGRNAAAKVFKR
I
ALIATRECCANPQCWSKNC
R
P06029 Co1.4 precursor A superfamily Conus coronatus
MGMRMMFTMFLLVVLAIAVVS
FTSDRASDGRNDAAKAFHRI
ALTAR
TGCCEYPYCAENNPELCG
GRR
P06030 Co1.5 precursor A superfamily Conus coronatus
MGMRMMFTMFLLVVLAIAVVS
FTSDRASDGRNDAAKAFHRI
ALTAR
TGCCEFPYCAENIPELCG
GRR
P06031 Co1.6 precursor A superfamily Conus coronatus
MGMRMMFTMFLLVVLATAVVS
YTSDRGPTSDGGNAAAKAFD
LMALIAR
DDCCLVASCWQRYPERCGG
GR
P06032 Co1.7 precursor A superfamily Conus coronatus
MGMRMMFTVFLLVVLATAAVS
FTSDRAYDGGNDAAKAFDWI
ALTAR
HECCSYPACAYTHPELCG
GRR
P03931 Cr4.1 precursor A superfamily Conus circumcisus (circumcision cone)
MFTVFLLVVLATTVVS
IPSDRASDGRNAAVNER
QPWLVPST
ITTCCGYDPGTKCPPCRCNNTCKPKKPKPGK
GRRND
P05898 Di1.1 precursor A superfamily Conus distans
MFTVFLLVVLATTVVS
FTSDHAFYHKNRRTSKR
LTSEELIE
CCVIESCHSNHIDECES
P05899 Di1.2 precursor A superfamily Conus distans
MFTVFLLVVLATTVVS
FTSDRAFNYKNYRTSKR
KVSEELNE
CCRIPPCLLDHADECES
P02937 Di1.3 precursor A superfamily Conus distans
MFTVFLLVVFASSVTL
DRASYGRYASPVDR
ASALIAQAILR
DCCSNPPCAHNNPDC
R
P03002 E1.1 precursor A superfamily Conus ermineus (Atlantic fish-hunting cone)
MFTVFLLVVLATTVGS
FTLDRASDGRDAAANDKASDLIALT
ARR
DPCCSNPACNVNNPQIC
G
P06046 Eb1.1 precursor A superfamily Conus ebraeus
MGMRMMFTMFLLVVLATTVVS
FTSDHASDGRNTAANDKASD
LMALR
DGCCSSPSCSVNNPDICGG
GR
P06047 Eb1.2 precursor A superfamily Conus ebraeus
MGMRMMFTLFLLAVLSTTVVS
FTLDRASNGRDAAADSKAAD
QIAQTVR
DECCSNPSCAQTHPEIC
RRTLMLQNPLNHDMSPS
A
P06051 Eb1.3 precursor A superfamily Conus ebraeus
MGMRMMFTVFLLVVLATAVVS
FTSDRASRGRNAAAKVFDR
I
ALIATRECCANPQCWAKNC
RGRRCYSRTL
P06048 Eb1.3 precursor A superfamily Conus ebraeus
MGMRMMFTVFLLVVLATAVVS
FSSDRASHGRNAAAKLFDR
I
ALIATRECCANPQCWAKNC
R
P06049 Eb1.6 precursor A superfamily Conus ebraeus
MGMRMMFTMFLLVVLAIAVVS
FTSDRASDGRNDAAKAFHRI
ALTAR
TGCCEFPYCAENIPELCG
GRR
P06050 Eb1.7 precursor A superfamily Conus ebraeus
MGMRMMFTVFLLVVLATAVAS
FTSDRASHGRNAAAKLFDR
I
ALIATRECCADPQCWAKNC
RGRRCYSRTV
P06052 Ec1.1 precursor A superfamily Conus emaciatus
MGMRMMFTVFLLVVLATAVVS
FTLDRPSDGGDAAAKAFDLM
ALTAR
LDCCDIHACWSAHPELCG
GRR
P06057 Ec1.2 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVFASSVTL
DRPYHGRYAPVVDRASALEA
QAVLR
GCCSDPPCAHKHC
R
P06054 Ec1.2 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVLAPSVTL
DRAYHDRYASVVDRASALTQ
AVLR
GCCSDPPCAHKHC
R
P06053 Ec1.2 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVFASS
VTLDRAYHGRYAPVVDRASALKA
QAVLR
GCCSDPPCAHKHC
R
P06055 Ec1.2 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVFASSVTL
DRPYHGRYTPVVDRASALKA
QAVLR
GCCSDPPCAHKHC
R
P06056 Ec1.5 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVFASS
VTLDRASRGRYIPVVDRASALMA
QADLR
GCCSNPPCARLNPAC
G
P06146 Ec1.7 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVFASS
VTLDRASHGR
YAAVVNRASALMA
QAVLRDCCSNPPCAHNIHCA
P06145 Ec1.8 precursor A superfamily Conus emaciatus
MGMRMMFIVFLLVVFASSVTL
DRPSHGR
YAAVVNRASALMA
HAALRDCCSDPPCAHNNPDC
R
P03000 EI precursor A superfamily Conus ermineus (Atlantic fish-hunting cone)
MFTVFLLVVLATTVGS
FTLDRASDGRDAAANDKASDLIALT
ARR
DPCCYHPTCNMSNPQIC
G
P03911 EIIA precursor A superfamily Conus ermineus (Atlantic fish-hunting cone)
MFIVFLLVVLATTVGSFTL
DRVLEGRNAAAIDNALDQRDPK
R
QTPGCCWNPACVKNRC
GRR
P03910 EIIA precursor A superfamily Conus ermineus (Atlantic fish-hunting cone)
MFIVFLLVVLATTVGSFTL
DRVLEGRNAKAIDNALDQRDPK
R
QTPGCCWNPACVKNRC
GRR
P02925 EpI precursor A superfamily Conus episcopatus
MFTVFLLVVLATTVVS
FTSDRASDSRKDAASGLIALTIK
GC
CSDPRCNMNNPDYC
G
P04506 Eu1.3 precursor A superfamily Conus eburneus
MGMRMMFTVFLLVVLATAVLP
VTLDRASDGRNAAANAKTAR
LIAPFIRDYCCPRGPCMVWC
G
P04548 Eu1.6 precursor A superfamily Conus eburneus
MGMRMMFTVFLLVVLATTVV
SFTSDRAPDGR
NAAAKAFGLI
TPTVRKGCCSNPACMLKNPNLC
P06006 Fla1.1 precursor A superfamily Conus flavidus
MGMRMIFTVFLLVALATTVAS
FTLDRASNGRNAAADNKPSD
WIALAIK
QCCRNPKCSQQGCP
P06007 Fla1.2 precursor A superfamily Conus flavidus
MGMRMMFTMFVLVVLATTVVS
FPLDHASNGRDAAAYDKATP
LIAR
DMEECCSHPACQGINPDYCD
P06008 Fla1.3 precursor A superfamily Conus flavidus
MGMRMMFTMLLLVVLATTVVS
FTLDHAFDGRNIAANNKATD
LMALPVR
GCCSDPPCRHKHQDLC
G
P06009 Fla1.3 precursor A superfamily Conus flavidus
MGMRMMFTMLLLVVLATTVVS
FTLDHAFDGRNTAANNKATD
LMALPVR
GCCSDPPCRHKHQDLC
G
P06010 Fla1.6 precursor A superfamily Conus flavidus
MGMRMMFTVFLLVALATTVASFTL
DHASNGRNAAADDNMSD
WIAQALKR
CCGNPPCAHVNCR
GRR
P06011 Fla1.7 precursor A superfamily Conus flavidus
MGMRMMFTVFLLVVLSTTVVS
LPVDHASNGRDAAADSNAAD
QIAQTAR
DPCCSNPSCAQTHPEIC
RRMLQNPLNHDMSPSA
P06012 Fla1.8 precursor A superfamily Conus flavidus
MGMRMMLTVFLLVVLATTVVS
DHASDGR
NTAAKVKYSKTQE
ECCPNPPCFAVNSALCGA
RR
P06005 Fla6.1 precursor A superfamily Conus flavidus
MGKRMVLTMFLLVVLATTVVS
FTLDHASDSRGTAANDKATD
QMALAVR
LDWCDDADFLVDHPELCGWDVCCAYPPCRHKHQD
CNQ
GR
P05705 G1.5 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVALATTVVS
FTSDRASDRRNAAVKAFDLI
SSTVKK
GCCSHPACSGNNPEYCRQ
GR
P05707 G1.6 precursor A superfamily Conus geographus (Geography cone)
MGMRIMFTVFLLVALATIVVS
FTSDRASDGR
NAAAKAFDLK
GCCSHPACSGNYQEYCRESY
P05709 G1.7 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLFLVLATTDVS
FTLDRASDGGNAAAKKSAVI
ALSRR
RCCGIKSCYENNKDMC
GRRR
P05715 G1.8 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLATTVVS
STSDRASDGRNAAASDKASD
LITQVVKR
CCGKPNDCLPSFAFVNGSCN
GRR
P05717 G1.9 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLATTVVS
FTSRRGPKSRR
GEPVPTTVI
NYGECCKDPSCWVKVKDFQCPGASPPN
P05723 G4.1 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVAWQRLVSS
TSDRASDGRNAAASDKASDL
ITQVVKR
CCGKPNAACHPCVCNGSCSG
GR
P05719 G4.1 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLATTVVS
STSDRASDGRNAAASDKASD
LITQVVKR
CCGKPNAACHPCVCNGSCS
GRR
P05721 G4.2 precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVSTWQRLS
FPPLQIVHLMAGMPQASDKAS
DLITQVVKR
CCGKPTSACHPCVCNGSCSG
GR
P02975 GI precursor A superfamily Conus geographus (Geography cone)
MFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSDMEKLV
EKK
ECCNPACGRHYSC
GR
P05714 GI precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSD
MDKLVEKK
ECCNPACGRHYSC
GR
P05713 GIB precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLATTVV
SFPSERASDGRDDTAKDEGSD
MEKLVEKK
ECCNPACGRHYSCK
GGR
P02983 GIB precursor A superfamily Conus geographus (Geography cone)
MFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSDMEKLV
EKK
ECCNPACGRHYSCKG
GR
P00097 GIC precursor A superfamily Conus geographus (Geography cone) SDGRNDAAKAFDLISSTVKK
GCCSHPACAGNNQHIC
GRRR
P05711 GID precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLAATIVS
FTSDRASDGRNVAAKAFHRI
GRT
IRDECCSNPACRVNNPHVC
RRR
P04221 GII precursor A superfamily Conus geographus (Geography cone)
MFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSDMDKLV
EKK
ECCHPACGKHFSC
GR
P05712 GII precursor A superfamily Conus geographus (Geography cone)
MGMRMMFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSD
MDKLVEKK
ECCHPACGKHFSC
GR
P04593 Im1.8 precursor A superfamily Conus imperialis
MGMRMMFTVFLLVVLATAVLP
VTLDRASDGRNAAANAKTAR
LIAPFIRDYCCPRGPCMVWC
G
P04066 Im1.95 precursor A superfamily Conus imperialis
MGMRMMFTVFLLVVLATTVVS
DRASNRENRR
ASNWNTRIAY
IGCCDIPDCYNKNREQCLDESS
G
P00093 ImI precursor A superfamily Conus imperialis IVRR
GCCSDPRCAWRC
G
P00092 ImII precursor A superfamily Conus imperialis IVRR
ACCSDRRCRWRC
G
P00078 ImIIA precursor A superfamily Conus imperialis
MGMRMMFTVFLLVVLATA
VLPVTLDRASDGRNAAANAKTPR
LIAPFIRD
YCCHRGPCMVWC
G
P00512 LeD2 precursor A superfamily Conus litteratus SDGRNDAASNKASHLIALAVR
GCCARAACAGIHQELCGGGR
P00544 LeD2 precursor A superfamily Conus litteratus
MGMRMMFIMFMLVVLATTV
DTFTSDRALDAMNAAASNKASR
LIALAVR
GCCARAACAGIHQELCGGRR
P00511 LiC22 precursor A superfamily Conus lividus SDGRNDAANDKASKLMVLR
NECCDNPPCKSSNPDLCDWRS
P00543 Lp1.1 precursor A superfamily Conus leopardus
MGMRMMFIMFMLVVLATTV
DTFTSDHALDAMNAAASNKASR
LIALAVR
GCCARAACAGIHQELC
GGRR
P00119 Lp1.1 precursor A superfamily Conus leopardus
MGMRMMFIMFMLVVLATTVVTFTS
DRALDAMNAAASNKASR
LIALAVR
GCCARAACAGIHQELC
GGGR
P00574 Lp1.10 precursor A superfamily Conus leopardus VVLGPASDGRNAAANVKAPDLIALTVR
NDCCHNAPCRNNHP
GIC
G
P00120 Lp1.2 precursor A superfamily Conus leopardus
MGMRMMFTVFLLVVLATTVVS
FTSDRAFDGRNAAASDKASD
LISLAVR
GCCSHPACSVNNPYFCG
GKR
P00121 Lp1.3 precursor A superfamily Conus leopardus
MGMRMMFIMFMLVVLATTVVS
FTSDRASDGRNAEAKALDLI
AATAR
PRCCSNPACGAGHPEICA
GRR
P00122 Lp1.4 precursor A superfamily Conus leopardus
MGMRMMFIMFMLVVLATTVVSFTS
DRALDAMNAAASKKASR
LIALAVR
GCCSHPACSGNHQELCD
GRR
P00546 Lp1.4 precursor A superfamily Conus leopardus
MGMRMMSIMFMLVVLATTVVSFTS
DRALDAMNAAASKKASR
LIALAVR
GCCSHPACSGNHQELCD
GRR
P00126 Lp1.5 precursor A superfamily Conus leopardus
MGMRMMFTVFLLVILASTV
TLDRASNGMNAAAIRKASALVA
QIAYR
DCCDDPACTVNNPGLCT
P01181 Lp1.6a precursor A superfamily Conus leopardus VVLGPASDGRNAPANNKVSDLIR
QFCCGHYDCDFIPNVC
G
P00547 Lp1.6a precursor A superfamily Conus leopardus
MGMRMMFIIFLFVVLATTVVSFTSG
RASDGRNAPANNKVSD
LIR
QFCCGHYDCDFIPNVC
G
P00573 Lp1.6b precursor A superfamily Conus leopardus VVLGPASDGRNAAANNKASDLIR
QICCGYGDCGFVPNVCV
P00553 Lp1.7 precursor A superfamily Conus leopardus
MGMRMMFTMFLLVVLTTTVVSFNS
DRESNHENRRTSNQITR
GMWDECCDDPPCRQNNMEHCPAS
P00552 Lp1.8 precursor A superfamily Conus leopardus
MGMRMMFTMFLLVVLTTTVVSFNS
DRESNHENRRTSNQITR
GVWDECCKDPQCRQNHMQHCPAR
P00566 Lp1.9 precursor A superfamily Conus leopardus SDDNDVAAEMMSGLIALAIDS
CCSDSDCNANHPDMCS
P04065 Lt1.46 precursor A superfamily Conus litteratus
MGMRMMFTVFLLVVLATTVV
SLTLDRASGGRRSGADNMIAL
LIIR
KCCSNPACNRYNKLC
P01152 Lt1C precursor A superfamily Conus litteratus
MGMRMMFTMFLLVVLTTTVVSF
NLDRESNHENRRTSNQITR
GMWD
ECCDDPPCRQNNMEHCPAS
P01151 LtIA precursor A superfamily Conus litteratus
MGMRMMFIMFMLVVLATTVVTFTS
DRALDAMNAAASNKASR
LIALAVR
GCCARAACAGIHQELC
GGGR
P06037 Lv1.10 precursor A superfamily Conus lividus
MGMRMMFTMFLLVVLSTTVVS
LPVDHASNGRDAAADSNAAD
QIAQTAR
DPCCSNPSCAQTHPEIC
RRMLQNPLNHDMSPSA
P06038 Lv1.11 precursor A superfamily Conus lividus
MGMRMMFTVFLLIVLATTVDS
FTSDRASDGGNAAAKAFDLM
ALTAR
LDCCDIHACWMYC
R
P06040 Lv1.13 precursor A superfamily Conus lividus
MGMRMMFTMFLLVVLAIAVVS
FTSDRASDGRNDAAKAFHRI
ALTAR
TGCCEFPYCAENIPELCG
GRR
P06033 Lv1.2 precursor A superfamily Conus lividus
MGMRMMSTVFLLVVLATAVVS
FTLDRASDGGNAAAKAFDLM
ALTAR
LDCCDIHACWSAHPELCG
GRR
P06034 Lv1.3 precursor A superfamily Conus lividus
MGMRMMFTVFLLVVLATAVVS
FTLDRASDGGNAAAKAFDLI
SLIAR
EDCCALHACWMYC
R
P06039 Lv1.3 precursor A superfamily Conus lividus
MGMRMMFTVFLLVVLATTVVS
FTSDRASHARNAAAKVFDLI
SLIAR
EDCCALHACWMYC
R
P06035 Lv1.4 precursor A superfamily Conus lividus
MGMRMMFTMLLLVVLATTVVS
FTLDHAFDGRNTAANNKATD
LMALPVR
GCCSDPPCRHKHQDLC
G
P06036 Lv1.9 precursor A superfamily Conus lividus
MGMRMMLTVFLLVVLATTVVS
DHASDGR
NTAAKVKYSKTQE
ECCPNPPCFAVNSALCGA
RR
P02999 M1.1 precursor A superfamily Conus magus (Magus cone)
MFTVFLLVVLTTTVVS
FPSDRASDGRDDEAKDERSDMYESK
RDGR
CCHPACGQNYSC
GR
P03943 M4.2 precursor A superfamily Conus magus (Magus cone)
MFTVFLLVVLATTVVS
IPSDRASDGRNAVVHER
APELVVTA
TTTCCGFDPMTWCPPCMCTYSCSHQRKKP
GRRND
P03944 M4.3 precursor A superfamily Conus magus (Magus cone)
MFTVFLLVVLATSVVS
IPSDRASDGGNAVVHER
APELVVTA
TTTCCGYDPMTICPPCMCTHSCPPKGKP
GRRND
P02492 Mi1.1 precursor A superfamily Conus miles
MGMRMMFTVFLLVVLATTVVS
FTSDRGSDGRNAAAKDKASD
LVALTVK
GCCSNPPCYANNQAYCN
GRR
P00008 MII precursor A superfamily Conus magus (Magus cone)
MGMRMMFTVFLLVVLATTVVS
FPSDRASDGRNAAANDKASD
VITLALK
GCCSNPVCHLEHSNLC
GRRR
P00018 MIVA precursor A superfamily Conus magus (Magus cone)
MGMRMMFTVFLLVVLATTVVS
IPSDRASDGRNAVVHER
APE
LVVTATTNCCGYNPMTICPPCMCTYSCPPKRKP
GRRND
P02985 Mn1.1 precursor A superfamily Conus monachus
MFTVFLLVVLTTTVVS
FPSDSASGGRDDEAKDERSDMYELK
R
NGHCCHPACGGKYVKC
GR
P02993 Mn1.2 precursor A superfamily Conus monachus
MFTVFLLVVLTTTVVS
YPSDSASDGRDDEAKDERSDMYKSK
R
NGRCCHPACGKHFSC
GR
P03949 Mn4.1 precursor A superfamily Conus monachus
MFTVFLLVVLATTLVSI
PSDRASDFRNAAVHER
QKELVVTA
TTTCCGYNPMTSCPRCMCDSSCNKKKP
GRRND
P03950 Mn4.2 precursor A superfamily Conus monachus
MFTVFPLVVLATTLVSIPSDR
ASDGRNAVVHER
QPWLVPSK
ITNCCGYNTMEMCPTCMCTYSCRPKKKKP
GRRND
P05365 Mr1.1 precursor A superfamily Conus marmoreus
MGMRMMSTVFLLVVLATTVVS
FTSDRASDGRKAAAKDKASD
LVALTVK
GCCSHPACSVNNPDIC
G
P00567 Mr1.1 precursor A superfamily Conus marmoreus SDGRNAAAKDKASDLVALTVK
GCCSHPACSVNNPDIC
G
P00123 Mr1.1 precursor A superfamily Conus marmoreus
MGMRMMFTVFLLVVLATTVVS
FTSDRASDGRKAAAKDKASD
LVALTVK
GCCSHPACSVNNPDIC
G
P00127 Mr1.2 precursor A superfamily Conus marmoreus
MGMRMMFTVFLLVVLATTVVSFTS
DRGSDGRNAAAKDKASD
LVALTVK
GCCSNPPCYANNQAYCN
GRR
P00541 Mr1.3 precursor A superfamily Conus marmoreus
MGMRMMFTMCLLVVLATTVISFTS
DRASNGRNAAAKDKASD
LNALNVR
GCCSHPACRVHYPHVCY
GRR
P04532 Mr1.7 precursor A superfamily Conus marmoreus
MGMRMMFTMFLLVVLATTVV
SFTSNRAFRRRNAVAKASDLI
ALNAR
RPECCTHPACHVSHPELC
G
P04571 Mr1.8 precursor A superfamily Conus marmoreus
MGMRMMFTVFLLVVLATTVV
SFTSNRVLDPAFRRRNAAAKA
SDLIALNAR
R
P
ECCTHPACHVSNPELC
S
P02947 O1.1 precursor A superfamily Conus obscurus
MFTVFLLVVLATTVVSP
TSDRASDRRNAAAKAFDLRYSTAK
R
GCCSNPVCWQNNAEYCRES
G
P02949 O1.2 precursor A superfamily Conus obscurus
MFTVFLLVVLATTVVS
FTSDRASDGGNVAASHLIALTIK
GC
CSHPPCAQNNQDYC
G
P02951 O1.3 precursor A superfamily Conus obscurus
MFTVFLLVVLSTTVVSS
TSDRASDRRNAAAKASDLMYSTVK
K
GCCSHPACSGNNREYCRES
G
P03004 P1.10 precursor A superfamily Conus purpurascens
MFTVFLLVVLVTTVVS
FNSDRALGGRNAAAKASDKIASILG
RR
ACCSYPPCNVNYPEICGGR
G
P00005 PeIA precursor A superfamily Conus pergrandis FDGRNAAANDKASDLVALTVR
GCCSHPACSVNHPELC
G
P00410 PIA precursor A superfamily Conus purpurascens SDGRDAAANDKATDLIALTAR
RDPCCSNPVCTVHNPQIC
G
P03011 PIA precursor A superfamily Conus purpurascens
MFTVFLLVVLATTVGS
FTLDRASDGRDAAANDKATDLIALT
ARR
DPCCSNPVCTVHNPQIC
G
P04222 PIVA precursor A superfamily Conus purpurascens
MFTVFLLVVLATTVV
SFTSDRASDDRNTNDKASRLLSHVVR
GCCGSYPNAACHPCSCKDRPSYCGQ
GR
P02916 Pn1.1 precursor A superfamily Conus pennaceus
MFTVFLLVVLATTVIS
FTSDRASDGGNAAASDLIALTIK
GC
CSHPPCAMNNPDYC
G
P02918 Pn1.2 precursor A superfamily Conus pennaceus
MFTVFLLVVLATTVVS
FTSDRASDGGNAAMSDLIALTIK
GC
CSHPPCFLNNPDYC
G
P00036 PnIB precursor A superfamily Conus pennaceus
MGMRMMFTVFLLVVLATTVVS
FTSDRASDDGNAAASDLIAL
TIK
GCCSLPPCALSNPDYC
G
P00037 PnMGMR-02 precursor A superfamily Conus pennaceus
MGMRMMFTVFLLVVLATTVVS
FTSDRASDGGNAAASDLIAL
TIK
GCCSRPPCALSNPDYC
G
P00542 Pu1.1 precursor A superfamily Conus pulicarius
MGMRMMFTVFLLVVLATTVVSFTS
DRTSDGRNAAFNAFDLI
ALTAR
QNCCNVPGCWAKYKHLC
GRKR
P01180 Pu1.1 precursor A superfamily Conus pulicarius VVLGPASDGRNAAFNAFDLIALTAR
QNCCNVPGCWAKYKHL
C
GRKR
P00568 Pu1.2 precursor A superfamily Conus pulicarius LDGRNAAADFETSDLLAMTIR
GGCCSYPPCIANNPLC
GGKR
P00569 Pu1.3 precursor A superfamily Conus pulicarius SDGRNAGADRKGFGLISQMFK
LSCCADPACKHTPGC
P02863 Pu1.4 precursor A superfamily Conus pulicarius
MFTVFLLVVLATTVVS
FPSDRDPASNHENSKGSNR
NAWFTP
EECCAAPACRGMILEFCLAGEAFAAALDGFRRLPYR
LSSE
P02865 Pu1.5 precursor A superfamily Conus pulicarius
MFTVFLLVILATTVVP
FPSDRDPASNHENSKGSNR
NAWLTP
EECCAAPACREMILEFCLAGEAFAAALDGFRRLPYR
LSSE
P02867 Pu1.6 precursor A superfamily Conus pulicarius
MFTVFLLVVLVT
TVVFSTSDHRPASNHENRRASKR
ISEMTW
EECCTNPVCRQHYMHYC
P03761 Pu14.1 precursor A superfamily Conus pulicarius
MGMRMMFAVFLLVVLATTVVS
FNSDRASDGRNAAANVKASD
LMAR
VLEKDCPPHPVPGMHKCVCLKTC
R
P03760 Pu14.2 precursor A superfamily Conus pulicarius
MGMRMMFTVFLLVVLATTVDS
FNSDRASDGR
DAEVVSTESD
VIVTCEPCMNPACGPNYGKC
R
P03759 Pu14.3 precursor A superfamily Conus pulicarius
MGMRMMFTVFLLVVLATTVDS
FNVDRASDDR
DSAAMHTEYD
VIATDNCIPCSHPACGINRGKC
R
P00077 putative peptide precursor A superfamily Conus imperialis
MGMRMMFTVFLLVVLATTVVPITLA
SATDGRNAAANARVSP
VISKSSKK
WCHPNPYTVG
P06064 Qc1.16 precursor A superfamily Conus quercinus
MGMRMMFTLFLLAVLSTTVVS
FTLDRASNGRDAAADSKAAD
QIAQTVR
DECCSNPSCAQTHPEIC
RRTLMLQNPLNHDMSPS
A
P06062 Qc1.17 precursor A superfamily Conus quercinus
MGMRMMFTVFLLVVLATAVVS
FSSDRASHGRNAAAKVFDR
I
ALIATRECCANPQCWAKNC
R
P06063 Qc1.18 precursor A superfamily Conus quercinus
MGMRMMFTMFLLVVLATTVVS
FTSDHASDGRNTAANDKASD
LMALR
DGCCSSPSCSVNNPDICGG
GR
P00117 Qc1.1a precursor A superfamily Conus quercinus
MGMRMMFTMFLLVVLAITVVSFTS
DHASDGRNTAANDKASN
LMALR
DECCPDPPCKASNPDLCDWRS
P00554 Qc1.1b precursor A superfamily Conus quercinus SDGRNTAANDKASKLMALR
NECCDNPPCKSSNPDLCDWRS
P00551 Qc1.1b precursor A superfamily Conus quercinus
MGMRMMFTMFLLVVLAITVVSFTS
DHASDGRNTAANDKASK
LMALR
NECCDNPPCKSSNPDLCDWRS
P00556 Qc1.1c precursor A superfamily Conus quercinus SDGRNTAANDKASNLMALR
DDCCPNPPCKASNPDLCDWRS
P00557 Qc1.2 precursor A superfamily Conus quercinus SNGRNAAADDKPSDWIALAIK
QCCANPPCKHVNC
R
P00118 Qc1.2 precursor A superfamily Conus quercinus
MGMRMMFTVFLLVALATTVASFTL
DRASNGRNAAADDKPSD
WIALAIK
QCCANPPCKHVNC
R
P00125 Qc1.4 precursor A superfamily Conus quercinus
MGMRMMFTVFLLVVLATTVTS
DRVSNGRKAAAKLKAPALME
LSVR
QGCCSDPACAVSNPDIC
GGGR
P00558 Qc1.4a precursor A superfamily Conus quercinus SDGRNTAANDKASDLMALR
DGCCSNPSCSVNNPDIC
GGGR
P00559 Qc1.4b precursor A superfamily Conus quercinus SDGRNTAANDKASDLMALR
DGCCPNPSCSVNNPDIC
GGGR
P00560 Qc1.5 precursor A superfamily Conus quercinus SDGRNAAADDKASDLIGLAVR
GCCSNPACSVNHPELC
GRRR
P00561 Qc1.6 precursor A superfamily Conus quercinus FDGRNAAASDKASELMALAVR
GCCSNPTCAGNNGNIC
G
P06065 Qc1.8 precursor A superfamily Conus quercinus
MGMRMMFTMFLLVVLAITVVS
FTSDHASDGRNTAANDKASN
LMALR
DECCPNPPCKASNPDLCDWRS
P00548 QcaL-1 precursor A superfamily Conus quercinus
MGMRMMFTMFLLVVLATTVVSIN
LDHAFDGRNAAANNKATD
LMARTVRR
FCSDPPCRISNPESCGWEP
P00555 QcaL-1 precursor A superfamily Conus quercinus FDGRNAAANNKATDLMARTVRR
FCSDPPCRISNPESCGWEP
P00549 Qcal-2 precursor A superfamily Conus quercinus
MGMRMMFTMFLLVVLATTVVSFN
LDHAFDGRNAAANNKATD
LMARTVRG
FCSDPSCRFGNPELCDWRR
P02977 R1.1 precursor A superfamily Conus radiatus
MFTVFLLVVLTITVVS
FPSDRASDGRDDEAKDERSDMYKSK
R
NGRCCHPACGKHFSC
GR
P02979 R1.2 precursor A superfamily Conus radiatus
MFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSDMEKLV
EKK
ECCNPACGRHYSCKG
GR
P02997 R1.3 precursor A superfamily Conus radiatus
MFTVFLLVVLATTVVS
FPSERASDGRDDTAKDEGSDMDKLV
EKK
ECCHPACGKHFSC
GR
P05529 RegIIA precursor A superfamily Conus regius
MGMRMMFTVFLLVVLTTTVVSS
TSVRASDGRNAAADNRASD
LIAQIVRR
GCCSHPACNVNNPHIC
G
P00593 RgIA precursor A superfamily Conus regius SNKRKNAAMLDMIAQHAIR
GCCSDPRCRYRCR
P06059 Rt1.1 precursor A superfamily Conus rattus
MGMRMMFTMFVLVVLATTVVS
FPLDHASNGRDAAAYDKATP
LIAR
DMEECCSHPACQGINPDYCD
P06060 Rt1.2 precursor A superfamily Conus rattus
MGMRMMFTMFLLVVLSTTVVS
LPVDHASNGRDAAADSNAAD
QIAQTAR
DPCCSNPSCAQTHPEIC
RRMLQNPLNHDMSPSA
P00012 S1.1 precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLLVVLAITVVS
FPLDRESDGANAEARTHDHE
KHALDR
NGCCRNPACESHRC
G
P06150 S1.10 precursor A superfamily Conus striatus (Striated cone)
MGMRMMFIVFLLVVLATTVVS
FPSDRASDGRDDEAKDVDMH
ESDRKGR
AYCCHPACGKNFDC
GR
P03958 S1.8 precursor A superfamily Conus striatus (Striated cone)
MFTVFLLVVLATTVV
SFTSDRASDGRDDEAKDERSDMHESD
RKGR
AYCCHPACGPNYSCGTSCS
RTL
P03959 S1.9 precursor A superfamily Conus striatus (Striated cone)
MFTVFLLVVLATTVV
SFTSDRASDGRDDEAKDERSDMHESD
RKGR
AYCCHPVCGKNFDC
GR
P06061 S4.4 precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLSVVLATTVVS
TPSDRASDGRNAAVHER
QKG
LVPSVITTCCGYDPGTMCPPCRCTNSCPKKPKKP
GRRND
P00076 SI precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLLVVLATTVVS
FPSDRASDGRDDEAKDERSD
MHESDRKE
ICCNPACGPKYSC
GR
P00009 SII precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLLVVLATTVVS
FPSDRASDGRDDEAKDERSD
MHESDRNGR
GCCCNPACGPNYGCGTSCS
RTL
P00091 SII precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLLVVLATTVVSFPS
DRASDGRDDEAKDERSD
MHESDRNGR
GCCCNPACGPNYGCGTSCS
RTI
P03900 SII precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLLVVLATTVVS
FTSDRASDGRDDEAKDERSD
MHESDRNGR
GCCCNPACGPNYGCGTSCS
RTL
P03954 SII precursor A superfamily Conus striatus (Striated cone)
MFTVFLLVVLTTTVV
SFPSDSASDGRDDEAKDERSDMHESD
RNGR
GCCCNPACGPNYGCGTSCS
RTI
P00094 SIVA precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLLVVLATTVVS
TPSDRASDGRNAAVHER
QKS
LVPSVITTCCGYDPGTMCPPCRCTNSC
G
P03960 SIVA precursor A superfamily Conus striatus (Striated cone)
MFTVFLLVVLATNVV
STPSDRASDGRNAAVHER
QKSLVPSV
ITTCCGYDPGTMCPPCRCTNSC
G
P02523 SIVB precursor A superfamily Conus striatus (Striated cone)
MGMRMMFTVFLSVVLATTVVSTPS
DRASDGRNAAVHER
QKE
LVPSVITTCCGYDPGTMCPPCRCTNSCPTKPKKP
GRRND
P02981 Sm1.1 precursor A superfamily Conus stercusmuscarum
MFTVFLLVVLATTVVS
FPSDRASDGRDDEAKDERSDMHESG
RKGR
GRCCHPACGPNYSC
GR
P02920 Sm1.2 precursor A superfamily Conus stercusmuscarum
MFTVFLLVVLATTVVS
FPSDRESDGANDEARTDEPEEHGPD
R
NGCCRNPACESHRC
G
P02904 Sm1.3 precursor A superfamily Conus stercusmuscarum
MFTVFLLVVLATTVVS
SPSDRASDGRNAAANEKASDVIALA
LK
GCCSNPVCHLEHSNMC
GRRR
P03952 Sm4.2 precursor A superfamily Conus stercusmuscarum
MFTVFLLVVLATTVV
SIPSDRASDGRNAAVNER
APWLVPST
ITTCCGYDPGTMCPPCMCNNTCKPTKKRP
GRRND
P00021 SmIVA precursor A superfamily Conus stercusmuscarum
MGMRMMFTVFLLVVLATTVVS
IPSDRASDGRNAAVNER
QTW
LVPSTITTCCGYDPGTMCPTCMCDNTCKPKPKKS
GRRND
P02528 SmIVB precursor A superfamily Conus stercusmuscarum
MGMRMMFTVFLLVVLATTVVSIPS
DRASDGRNAEVNER
APW
LVPSTITTCCGYDPGSMCPPCMCNNTCKPKPKKS
GRRNH
P02927 Sp1.1 precursor A superfamily Conus sponsalis
MSTVFLLVVLATTVVS
FTVDRASDGRDVAIDDR
LVSLPQIA
HADCCSDPACKQTPGC
R
P02929 Sp1.2 precursor A superfamily Conus sponsalis
MFTVFLLVVLATTVAS
FIIDDPSDGRNIAVDDR
GLFSTLFH
ADCCENPACRHTQGC
P03751 SrIA/SrIB precursor A superfamily Conus spurius
MGMRMMFTVFLLVVLATTVVS
FTSDSAFDSRNVAANDKVSD
MIALTAR
RTCCSRPTCRMEYPELCG
GRR
P02892 Su1.1 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVS
FNSDRDPALGGRNAAAKASDKIAST
LKR
RGCCSYFDCRMMFPEMCGWR
G
P02894 Su1.2 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVS
FNSDRDPALGGRNAAAIASDKIAST
LRRG
GCCSFPACRKYRPEMCG
GRR
P02896 Su1.3 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVS
FTSDHESDR
GDAQTIQEVFEMFALD
SDGCCWHPACGRHYC
GRRR
P02898 Su1.4 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVS
FNSDRDPALGGRNAAAIASDKIAST
LRRG
GCCSFAACRKYRPEMCG
GRR
P02900 Su1.5 precursor A superfamily Conus sulcatus
MFTVFLLVLLATTVVS
FNSDRALGGRNAAAKASDKILSNLR
RG
GCCFHPVCYINLLEMCRQR
G
P03006 Su1.6 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVP
FNSDRDPALGGRNAAAIASDKIAST
LRRG
GCCSYPPCNVSYPEICG
GRR
P03008 Su1.7 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVS
FNSDRALGGRNAAAKASDKIASILG
RRR
CCSYPPCNVSYPEICG
GRR
P03010 Su1.8 precursor A superfamily Conus sulcatus
MFTVFLLVVLATTVVS
FNSDRALGGRNAAAKASDKIASILG
RR
ACCSYPPCNVNYPEICGGR
G
P03961 Sx4.1 precursor A superfamily Conus striolatus
MFTVFLLVVLATTVV
SIPSDRAYDGKNAAVHER
QSWLVPST
ITTCCGYSPGTMCPPCMCTNTC
P02888 T1.1 precursor A superfamily Conus tulipa (tulip cone)
MFTVFLLVVLATTVVS
FPSDIATEGRNAAAKAFDLISSIVK
K
GCCSHPACSGNNPEFCRQ
GR
P02890 T1.2 precursor A superfamily Conus tulipa (tulip cone)
MFTVFLLVVLATTVVS
FPSDIATEGRNAAAKAFDLISSIVR
KGCCSNPACAGNNPHVCRQ
GR
P06058 Tr1.1 precursor A superfamily Conus terebra
MGMRMMFIAFLLVVFASS
VTLDRASHGRYAAVVDR
ASAPIS
QAILRDCCSNPPCAHNNPDC
R
P06147 Tr1.2 precursor A superfamily Conus terebra
MGMRMMFIVFLLVVFASS
VTLDRASHGRYAAVVDR
ASALIS
QAILRDCCSNPPCAHNNPDC
R
P02880 Tx1 precursor A superfamily Conus textile (Cloth-of-gold cone)
MFTVFLLVVLATTVVSFSSG
RSTFRGRNAAAKASGLVSLTD
RR
PECCSDPRCNSSHPELCG
GRR
P00513 Tx1 precursor A superfamily Conus textile (Cloth-of-gold cone) SDGRNDAAKASGLVSLTDRR
PECCSDPRCNSSHPELCG
P00052 Tx1 precursor A superfamily Conus textile (Cloth-of-gold cone)
MGMRMMFVVFLLVVLASTVVS
STSGRRAFHGRNAAAKASGL
VSLTDRR
PECCSDPRCNSSHPELCG
GRR
P02884 Tx1.2 precursor A superfamily Conus textile (Cloth-of-gold cone)
MFTVFLLVVLATTVVSFTSG
RSTFRGRNAAAKASGLVSLTD
R
RPQCCSHPACNVDHPEIC
R
P06041 Tx1.3 precursor A superfamily Conus textile (Cloth-of-gold cone)
MGMRMMFTVFLLVVLATAVVS
FTSDRASDDRKAAASDLITL
TIK
GCCSRPPCIANDPDLC
G
P02886 Tx1.4 precursor A superfamily Conus radiatus
MFTVFLLVVLATTVVSFTSG
RSTFRGRNAAAKASGLVSLTD
RR
PQCCSHPACNVDHPEICD
P00053 Tx2 precursor A superfamily Conus textile (Cloth-of-gold cone)
MGMRMMFTVFLLVVLATTVVS
FTSGRRTFHGRNAAAKASGL
VSLTDRR
PECCSHPACNVDHPEICR
P02882 TxIA precursor A superfamily Conus textile (Cloth-of-gold cone)
MFTVFLLVVLATAVVS
FTSDRASDDGKAAASDLITLTIK
GC
CSRPPCIANNPDLC
G
P04199 Vc1.2 precursor A superfamily Conus victoriae
MGMRMMFTVFLLVVLATTVVFFTSDR
ASDGRKAAASDLITL
TIK
GCCSNPACMVNNPQIC
GRRR
P04201 Vc1.3 precursor A superfamily Conus victoriae
MGMRMMFTVFLLVVLATTVVSFTS
DRASDGRKAAASDLITL
TIK
GCCSDPPCIANNPDLC
GRRR
P06393 Vc22.1 precursor A superfamily Conus victoriae
MGMRMMFTVFLSVVLATTLVSFTSG
RRDKASHQKR
DCPVTG
GPNPFHHCKIACMSTGTEEYCNCVYCKDCVNSNGEKPAC
P00499 VcIA precursor A superfamily Conus victoriae
MGMRMMFTVFLLVVLATTVVSSTSG
RREFRGRNAAAKASDL
VSLTDKKR
GCCSDPRCNYDHPEIC
G
P04567 Vi1.6 precursor A superfamily Conus virgo
MGMRMMFVVFLLVVFASSVTL
DRASYGRYASPVDR
ASALIA
QAILRDCCSNPPCAHNNPDC
R
P04547 Vi1.7 precursor A superfamily Conus virgo
MGMRMMFTVFLLVVLATTVV
SFTSDRAPDGR
NAAAKAFGLI
TPTVRKGCCSNPACMLKNPNLC
P06149 Vr1.1 precursor A superfamily Conus varius
MGMRMMFILFLLVVLATTVVS
FPSDRASDGVNTAAELIAR
A
TWDYCCPPYICDTHFPSHC
K
P06148 Vr1.2 precursor A superfamily Conus varius
MGMRMMFIVFLLIVLATTVVS
FTSDRAFDGGNAAADMITR
A
IGGTCCPIPSCASTFPRLC
G
P04062 Vt1.23 precursor A superfamily Conus vitulinus
MGMRMMFTVFLLVVLATTVI
SFTSDRASDDGNSAVDLKAR
T
VIMHNCCTRSFCKRIYPDLCS
P04064 Vt1.24 precursor A superfamily Conus vitulinus
MGMRMMFTVFLLVVLATTVV
SFTLDRASDGANAAADLVAR
G
IRGNCCMFHTCPIDYSRFYCP
P04063 Vt1.27 precursor A superfamily Conus vitulinus
MGMRMMFTVFLLVVLATTVV
SFTLDRASDGASAAADLVAR
G
IRGNCCMFHTCPIDYSRFNCP