Protein List

Your search: Gene superfamily in [B1 superfamily] and Protein Type in [Precursor]

Found 53 entries.


ID Name Gene superfamily Organism Sequence
P04202 Conantokin-Br precursor B1 superfamily Conus sulcatus
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGKNAR
GDE
EYSKFIEREREAGRLDLSKFP
P03686 Conantokin-Br precursor B1 superfamily Conus sulcatus
MQLYTYLYLLVPLVTFHLILG
TGTLGHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGKNAR
GDE
EYSKFIEREREAGRLDLSKFP
P07677 Conantokin-Ca1 precursor B1 superfamily Conus caracteristicus LLQKSAARSTDDNGKDRLTQRKRTLKKRGNMAR
GYEEDREI
AETVRELEEAGK
P07678 Conantokin-Ca2 precursor B1 superfamily Conus caracteristicus EPVLLQKSAARSTDDNGKDRLTQRKRFFKMRGNTAR
GLEEE
LEEYVREI
P03533 Conantokin-E precursor B1 superfamily Conus ermineus (Atlantic fish-hunting cone)
LLVPLVTFHLILGMGTLDHGGALT
ERRSADATALKPEPVLL
QKSDARSTDDNDKDRLTQMKRILKKRGNKAR
GEEEHSKYQE
CLREIRVNNVQQEC
P04495 Conantokin-Eu1 precursor B1 superfamily Conus eburneus
MHLYTYLYLLVPLVTFHLILG
TGTLAHGGALTERRSADATA
LKPEPVLLQKSAARSTDDNGKDRLTQMNRILKKRGNAAR
DA
EEVRESAETLHEISVY
P01373 Conantokin-G precursor B1 superfamily Conus geographus (Geography cone)
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EELQENQELIREKSN
GKR
P01353 Conantokin-G precursor (variant) B1 superfamily Conus geographus (Geography cone)
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EEVQENQELIREKSN
GKR
P05724 Conantokin-G2 precursor B1 superfamily Conus geographus (Geography cone)
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EEVQENQELIREASN
GKR
P07763 Conantokin-Ge1 precursor B1 superfamily Conus generalis
MQLYTHLYLLVPLVTFHLILG
TGTLAHGDALTERRSADATA
LKPEPVLLQKSAARSTDDNGKDRLTQMNRILKKRGDTAR
GL
EEDLELRLLENSKKQENEK
P01374 Conantokin-L precursor B1 superfamily Conus lynceus
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDAIA
LKPEPVLLQKSSARSTDDNGNDRLTQMKRILKKRGNKAR
GE
EEVAKMAAELAREDAVN
GK
P04500 Conantokin-L2.10 precursor B1 superfamily Conus litteratus
MHLYTYLYLLVPLVTFHLILG
TGTLAHGDALTERRSADATA
LKPEPVLLQKSAARSTDDNGMDRLTQRKRTLRKRGNTAR
GL
EEELETVELVEELQQA
KKKKPIV
P04499 Conantokin-L2.2 precursor B1 superfamily Conus litteratus
MHLYTYLYLLVPLVTFHLILG
TGTLAHGDALTERRSDDATA
LKPEPVLLQKSAARSTNDNGMDRSIKRKRILKKRGNTAR
GP
EEDSETTVEELHEI
GKKKNL
P03531 Conantokin-P precursor B1 superfamily Conus purpurascens
MQLYTYLYLLVPLVTFHLILSTGTLA
HGGTLTERRSTDTTA
LKPEPVLLQKSDARSTDDNDKDRLTQMKRILKKRGNKAR
GE
EEHSKYQECLREIRVNKVQQEC
P05674 conantokin-Pu1 precursor B1 superfamily Conus pulicarius
MQLYTHLYLLVPLVVFNLIVGTGMLAHG
GSLTERRSADATA
LKPEPVLLQKSAARSIDDNGKDRLTQRKRTLKKRGNMAR
GY
EEGREVAETVRELEEA
RKMKKINQAGCST
P05676 conantokin-Pu2 precursor B1 superfamily Conus pulicarius
MQLYTYLYLLVPLVTFYLILGTGTLA
HGGTLTERRLADATA
LKPEPVLLQKTAARSIDDNGKDRLTQRKRILKKRGNTAR
GL
EEDLEIAEMVNELEEIG
KR
P07814 Conantokin-Qc1 precursor B1 superfamily Conus quercinus
MQLYTHLYLLVPLVAFHLIL
GTGTLAHGDALIERRSADATA
LKPEPVLLQKSAARSTDDNGKDRLTQMKRILKKRGNTAR
GY
EEDREVAETVRELEVA
GKRKRLI
P07815 Conantokin-Qc2 precursor B1 superfamily Conus quercinus
MQSFTCMCLLVPLLFFHLAQRSD
TAGHGGAATDVRSADHTL
KRFLHDFRRAPKRRSNGRYDRRQSTSVGLAKEILAERLHE
G
QEERAEDSREASLEKLREI
GR
P07816 Conantokin-Qc3 precursor B1 superfamily Conus quercinus
MQSFTCMCLLVPLLFFHLAQRSD
TAGHGGAATDVRSADHTL
KRFHHDFRRAPKRRSNGRYDRRQSISVGLATEILAEGYR
ED
SREAAVEKLQEI
GR
P01375 Conantokin-R precursor B1 superfamily Conus radiatus
MQLYTYLYLLVSLVTFYLILGTGT
LGHGGALTERRSTDATA
LKPEPVLLQKSSARSTDDNGNDRLTQMKRILKKRGNKAR
GE
EEVAKMAAELARENIAKGCKVNCYP
P05843 conantokin-Rl1 precursor B1 superfamily Conus rolani
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGNNPR
ADE
EYLKFIEEQRKQGKLDPTKFP
P05849 Conantokin-Rl2 precursor B1 superfamily Conus rolani
MQLYTYLYLLVPLVTFHLILG
TGTLDHGDALTERRSTDATA
LKPEPVLLQKSSARSTNDNGKDTQMKRILKKRGNKAR
GEEE
LAEKAPEFARELAN
P05850 Conantokin-Rl3 precursor B1 superfamily Conus rolani
MQLYTYLYLLVPLVTFHLILG
TGTLDHGDALTERRSADATA
LKPEPVLLQKSSARSTDDNGKDTQMKRIFKKRRNKAR
GEEE
LSENAVEFARELAN
P07946 Conantokin-T10 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEV
P07947 Conantokin-T11 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREDRS
P07948 Conantokin-T12 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLGKSKRSRS
P07949 Conantokin-T13 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKNVGKSKRSRS
P07950 Conantokin-T14 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLRESRS
P07951 Conantokin-T15 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKDVGKSKRSRS
P07952 Conantokin-T16 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYTKDVRKSKRSRS
P07954 Conantokin-T17 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLEKSKRSRS
P07955 Conantokin-T18 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAED
P07956 Conantokin-T19 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREARS
P07938 Conantokin-T2 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKIVGKI
P07957 Conantokin-T20 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLKRKQES
P07958 Conantokin-T21 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKNAGKR
P07959 Conantokin-T22 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKNRQEKE
P07960 Conantokin-T23 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKNDRKKINQS
P07961 Conantokin-T24 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKCRKKIIKLGVPPYTRQF
P07962 Conantokin-T25 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKNSRKKIIKLGVPPYTRQF
P07963 Conantokin-T26 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKNDRKKIIKLGVPPYTRQF
P07964 Conantokin-T27 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEAKKGKDNQSWVFHLIPVSSKIPR
P07965 Conantokin-T28 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEVKKNRQEKDNQSWVFHLIPVSSKIPR
P07966 Conantokin-T29 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEAKKGKDNQAGCSTLYPSVLKSPDRSFP
IFATFFLSLFL
P07939 Conantokin-T3 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLGKY
P07967 Conantokin-T30 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKMLENLREAEAKKRKKIIKAGCSTLYPSVLKSPDRSF
PIFATFFLSLFL
P07940 Conantokin-T4 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYTKDSWKI
P07941 Conantokin-T5 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKDVRKI
P07942 Conantokin-T6 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKIVRKI
P07943 Conantokin-T7 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYQKDVGKI
P07944 Conantokin-T8 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRANKAR
GE
EEYTKDVRKI
P07945 Conantokin-T9 precursor B1 superfamily Conus tulipa (tulip cone)
MHLYTYLYLLVPLVTFHLILGTG
TLDHGGALTERRSADATA
LKAEPVLLQKSARPQHRRQWQGQVDSDEEDSTNSETNKAR
G
EEEYTKDVRKY
P04497 Conantokin-V precursor B1 superfamily Conus vitulinus
MHLYTYLYLLVPLLTFHLIQG
TGLPGHGAALNEGRSADAAA
LKPEPVLLRKSAARSTNDNGKDRLTQMKRTLEKRGNTAR
DD
EVEIIVL