Protein List

Your search: Gene superfamily in [B1 superfamily] and Protein Type in [Precursor]

Found 18 entries.


ID Name Gene superfamily Organism Sequence
P03686 Conantokin-Br precursor B1 superfamily Conus sulcatus
MQLYTYLYLLVPLVTFHLILG
TGTLGHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGKNAR
GDE
EYSKFIEREREAGRLDLSKFP
P04202 Conantokin-Br precursor B1 superfamily Conus sulcatus
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGKNAR
GDE
EYSKFIEREREAGRLDLSKFP
P03533 Conantokin-E precursor B1 superfamily Conus ermineus (Atlantic fish-hunting cone)
LLVPLVTFHLILGMGTLDHGGALT
ERRSADATALKPEPVLL
QKSDARSTDDNDKDRLTQMKRILKKRGNKAR
GEEEHSKYQE
CLREIRVNNVQQEC
P04495 Conantokin-Eu1 precursor B1 superfamily Conus eburneus
MHLYTYLYLLVPLVTFHLILG
TGTLAHGGALTERRSADATA
LKPEPVLLQKSAARSTDDNGKDRLTQMNRILKKRGNAAR
DA
EEVRESAETLHEISVY
P01373 Conantokin-G precursor B1 superfamily Conus geographus (Geography cone)
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EELQENQELIREKSN
GKR
P01353 Conantokin-G precursor (variant) B1 superfamily Conus geographus (Geography cone)
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EEVQENQELIREKSN
GKR
P05724 Conantokin-G2 precursor B1 superfamily Conus geographus (Geography cone)
MHLYTYLYLLVPLVTFHLILG
TGTLDDGGALTERRSADATA
LKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
GE
EEVQENQELIREASN
GKR
P01374 Conantokin-L precursor B1 superfamily Conus lynceus
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDAIA
LKPEPVLLQKSSARSTDDNGNDRLTQMKRILKKRGNKAR
GE
EEVAKMAAELAREDAVN
GK
P04500 Conantokin-L2.10 precursor B1 superfamily Conus litteratus
MHLYTYLYLLVPLVTFHLILG
TGTLAHGDALTERRSADATA
LKPEPVLLQKSAARSTDDNGMDRLTQRKRTLRKRGNTAR
GL
EEELETVELVEELQQA
KKKKPIV
P04499 Conantokin-L2.2 precursor B1 superfamily Conus litteratus
MHLYTYLYLLVPLVTFHLILG
TGTLAHGDALTERRSDDATA
LKPEPVLLQKSAARSTNDNGMDRSIKRKRILKKRGNTAR
GP
EEDSETTVEELHEI
GKKKNL
P03531 Conantokin-P precursor B1 superfamily Conus purpurascens
MQLYTYLYLLVPLVTFHLILSTGTLA
HGGTLTERRSTDTTA
LKPEPVLLQKSDARSTDDNDKDRLTQMKRILKKRGNKAR
GE
EEHSKYQECLREIRVNKVQQEC
P05674 conantokin-Pu1 precursor B1 superfamily Conus pulicarius
MQLYTHLYLLVPLVVFNLIVGTGMLAHG
GSLTERRSADATA
LKPEPVLLQKSAARSIDDNGKDRLTQRKRTLKKRGNMAR
GY
EEGREVAETVRELEEA
RKMKKINQAGCST
P05676 conantokin-Pu2 precursor B1 superfamily Conus pulicarius
MQLYTYLYLLVPLVTFYLILGTGTLA
HGGTLTERRLADATA
LKPEPVLLQKTAARSIDDNGKDRLTQRKRILKKRGNTAR
GL
EEDLEIAEMVNELEEIG
KR
P01375 Conantokin-R precursor B1 superfamily Conus radiatus
MQLYTYLYLLVSLVTFYLILGTGT
LGHGGALTERRSTDATA
LKPEPVLLQKSSARSTDDNGNDRLTQMKRILKKRGNKAR
GE
EEVAKMAAELARENIAKGCKVNCYP
P05843 conantokin-Rl1 precursor B1 superfamily Conus rolani
MQLYTYLYLLVPLVTFHLILG
TGTLDHGGALTERRSTDATA
LKPEPVLQKSAARSTDDNGKDRLTQMKRILKKRGNNPR
ADE
EYLKFIEEQRKQGKLDPTKFP
P05849 Conantokin-Rl2 precursor B1 superfamily Conus rolani
MQLYTYLYLLVPLVTFHLILG
TGTLDHGDALTERRSTDATA
LKPEPVLLQKSSARSTNDNGKDTQMKRILKKRGNKAR
GEEE
LAEKAPEFARELAN
P05850 Conantokin-Rl3 precursor B1 superfamily Conus rolani
MQLYTYLYLLVPLVTFHLILG
TGTLDHGDALTERRSADATA
LKPEPVLLQKSSARSTDDNGKDTQMKRIFKKRRNKAR
GEEE
LSENAVEFARELAN
P04497 Conantokin-V precursor B1 superfamily Conus vitulinus
MHLYTYLYLLVPLLTFHLIQG
TGLPGHGAALNEGRSADAAA
LKPEPVLLRKSAARSTNDNGKDRLTQMKRTLEKRGNTAR
DD
EVEIIVL