Protein List

Your search: Gene superfamily in [B2 superfamily] and Protein Type in [Precursor]

Found 2 entries.


ID Name Gene superfamily Organism Sequence
P05492 Mr8.2 precursor B2 superfamily Conus marmoreus
MLRLITAAVLVSACLA
YPQKKRTPPQTRPTSR
ALVSQCRPC
PTCRECKCRECKCRECQCRIHSCLSAWDSRGIWMRT
P06319 Vc1_B2 precursor B2 superfamily Conus victoriae
MLRLIIAAVLVCACLA
YPQKRDGAPADAANLQGFDQGMMAM
PNMQPMQPVPMMQGPFMPFNPGFGGMGYKR
DLDEDPEQKRH
HSQFNEDNISPFNTDEGLGNFMNFMNDNGNSLPFANVNSDD
LGLDSFQPSAGKEEGKFRFFDGQQ