Protein List

Your search: Gene superfamily in [B2 superfamily] and Protein Type in [Precursor]

Found 4 entries.


ID Name Gene superfamily Organism Sequence
P07968 Conantokin-T31 precursor B2 superfamily Conus tulipa (tulip cone)
MLRLIIAAVLASACLAY
PQRRDGVPEDASNLQGFDQGMQAM
PNMQGMQGMPMPGMAGGQFLPFNPNLAVPYKR
GEELEERSH
HSKFNGDSDNSPFQSEDGLETSWTS
P07969 Conantokin-T32 precursor B2 superfamily Conus tulipa (tulip cone)
MLRLIIAAVLASACLAY
PQRRDGVPEDASNLQGFDQGMQAM
PNMQGMQGMPMPGMAGGQFLPFNPNLAVPYKR
GEELEERSH
HSKFNGDSDNSPFQSEDGLENFMDFMKDNSNENLPLQQRGR
RHQ
P05492 Mr8.2 precursor B2 superfamily Conus marmoreus
MLRLITAAVLVSACLA
YPQKKRTPPQTRPTSR
ALVSQCRPC
PTCRECKCRECKCRECQCRIHSCLSAWDSRGIWMRT
P06319 Vc1_B2 precursor B2 superfamily Conus victoriae
MLRLIIAAVLVCACLA
YPQKRDGAPADAANLQGFDQGMMAM
PNMQPMQPVPMMQGPFMPFNPGFGGMGYKR
DLDEDPEQKRH
HSQFNEDNISPFNTDEGLGNFMNFMNDNGNSLPFANVNSDD
LGLDSFQPSAGKEEGKFRFFDGQQ