Protein List

Your search: Gene superfamily in [D superfamily] and Protein Type in [Precursor]

Found 29 entries.


ID Name Gene superfamily Organism Sequence
P03586 Cp20.1 precursor D superfamily Conus capitaneus
MPKLEMMLLVLLIFPLSYFIAAGG
QVVQVDRRGDGLAGYLQ
RG
DRDVQDCQVSTPGSKWGRCCLNRVCGPMCCPASHCYCVY
HRGRGHGCSC
P03588 Cp20.2 precursor D superfamily Conus capitaneus
MPKLAVVLLVLLILPLSYFDAAGG
QAVQWDRRGNGLARYLQ
RGDR
DVRECQVDTPGSSWGKCCMTRMCGTMCCSRSVCTCVY
HWRRGHGCSCPG
P03590 Cp20.3 precursor D superfamily Conus capitaneus
MPKLAVVLLVLLILPLSYFDAAGG
QAVQGDRRGNGLARYLQ
RGDR
EVQECQVDTPGSSWGKCCMTRMCGTMCCSRSVCTCVY
HWRRGHGCSCPG
P03592 Cp20.4 precursor D superfamily Conus capitaneus
MPKLEMMLVVLLIFPLFYFDAAGG
QAVQGDRRGDGLARYLQ
RGDR
NDESECIISTPGSSWGRCCLTRMCGTMCCPRSGCYCV
YHWRRGHGCACSD
P03594 Cp20.5 precursor D superfamily Conus capitaneus
MPKLAVVLLVLLILPLSYFDAAGG
QAVQGDRRGNGLARYLQ
RNGR
DNEAECQIDTPGSSWGKCCMTRMCGTMCCSRSVCTCV
YHWRRGHGCSCPG
P04570 Im20.2 precursor D superfamily Conus imperialis
MPKLEMMLLVLLILPLCYIDAGLL
EPWVLEEKEIIQRWIDR
NCDSPNFQAWAMCCLESRCGTGGCCSQEVCDCNGPQSKECN
CPP
P04540 Lt15.2 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQK
L
HCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPACTCP
PCL
P04541 Lt15.3 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQK
L
HCHEISDPTPWILCSPEPLCGGKGCCAQEVCDCSGPVCTCP
PCL
P04546 Lt15.5 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQE
L
HCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPVCTCP
PCL
P04545 Lt15.5 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQK
L
HCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPVCTCP
PCL
P04542 Lt15.6 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPLPPWNMEDEIIEHWQK
L
HCYEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGPACTCP
PCL
P04544 Lt15.7 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQK
L
HCHEISDLTPWILCSPEPLCGGKGCCAQGVCDCSGPACTCP
PCL
P04543 Lt15.9 precursor D superfamily Conus litteratus
MPKLEMMLLVLLILPLCYIDA
VGPPPPWNMEDEIIEHWQK
L
HCHEISDLTPWILCSPEPLCGGKGCCAQEVCDCSGTACTCP
PCL
P06716 Mi039 precursor D superfamily Conus miles
MPKLEMMLLVLLILPLYYFSAAGG
QVVQGDWRGEGLARYLQ
RGDR
DAQECQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGRGHGCSC
P03606 Ml20.1 precursor D superfamily Conus miles
MPKLEMMLLVLLILPLSSFSAAGE
QVVQGDRRSDGLARYLQ
RGG
RDVQECQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGKGHGCSC
P03608 Ml20.2 precursor D superfamily Conus miles
MPKLEMMLLVLLILPLSSFSAAGE
QVVQGDQRSDGLARYLQ
RGGR
DVQECQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGRGHGCSC
P03610 Ml20.3 precursor D superfamily Conus miles
MPKLEMMLLVLLILPLSYFSAAGG
QVVQGDWRGDGLARYLQ
RGDR
DAQGCQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIY
HRGRGHGCSC
P03612 Ml20.4 precursor D superfamily Conus miles
MPKLEMMLLVLLIFPLSYFIAAGG
QVVQVDRRGDGLAGYLQ
RGDR
DVQDCQVSTPGSKWGRCCLNRVCGPMCCPASHCYCVY
HRGRGHGCSC
P03596 Ms20.1 precursor D superfamily Conus mustelinus
MLKLEMMLVVLLILPLFYFDAGG
QVVQRDWRSDGLARYLQR
GDR
DVRECNINTPGSSWGKCCLTRMCGPMCCARSGCTCVYH
WRRGHGCSCPG
P03598 Ms20.2 precursor D superfamily Conus mustelinus
MLKLEMMLVVLLILPLFYFDAGG
QVVQGDWRSDGLARYLQR
GD
RDVRECNINTPGSSWGKCCLTRMCGTMCCARSGCTCVYH
WRRGHGCSCPG
P03600 Ms20.3 precursor D superfamily Conus mustelinus
MPKLAVVLLVLLILPLSYFDAAGG
QVVQGDRRGNGLARYLQ
RGDR
DVRECQVNTPGSSWGKCCMTRMCGTMCCARSGCTCVY
HWRRGHGCSCPG
P03728 Ms20.3 precursor D superfamily Conus mustelinus
MPKLAVVLLVLLILPLSYFDAAG
G
QVVQGDRRGNGLARYLQ
RGDR
DVRECQVNTPGSKWGKCCMTRMCGTMCCARSGCTCVY
HWRRGHGCSCPG
P03602 Ms20.4 precursor D superfamily Conus mustelinus
MPKLAVVLLVLLILPLSYFDVAGG
QAAEGDRRGNGLARYPQ
RGGR
DNEAECQINTPGSSWGKCCMTRMCGTMCCARSGCTCV
YHWRRGHGCSCPG
P03604 Ms20.5 precursor D superfamily Conus mustelinus
MPKLAVVLLVLLILPLSYFDAAGG
QAAEGDRRGNGLARYLQ
RGG
RDNEAECQINTPGSSWGKCCLTRMCGPMCCARSGCTCV
YHWRRGHGCSCPG
P03614 Rt20.1 precursor D superfamily Conus rattus
MPKLEMMLLVLLILPLSYFSAAGG
QVVQGDLRSDVLARYLQ
RGDR
DARECQVNTPGSRWGKCCLNRMCGPMCCPESHCYCVY
HRRRGHGCSC
P03616 Rt20.2 precursor D superfamily Conus rattus
MPKLEMMLLVLLILPLSYFSAAGG
QVVQGDLHSDVLARYLQ
RGDR
DARECQVNTPGSRWGKCCLNRMCGPMCCPESHCYCIY
HRRRGHGCSC
P03618 Vt20.1 precursor D superfamily Conus vitulinus
MPKLAVVLLVLLILPLSYFDAGG
QAVQGDWRGNRLARDLQR
GGR
DDESECIINTRDSPWGRCCRTRMCGSMCCPRNGCTCVY
HWRRGHGCSCPG
P03630 VxXXA precursor D superfamily Conus vexillum
MPKLEMMLLVLLIFPLSYFIAAGG
QVVQVDRRGDGLAGYLQ
RGDR
DVQDCQVSTPGSKWGRCCLNRVCGPMCCPASHCYCVY
HRGRGHGCSC
P03631 VxXXB precursor D superfamily Conus vexillum
MPKLAVVLLVLLILPLSYFDAAGG
QAVQGDWRGNRLARDLQ
RGGR
DDESECIINTRDSPWGRCCRTRMCGSMCCPRNGCTCV
YHWRRGHGCSCPG