Protein List

Your search: Gene superfamily in [Divergent M---L-LTVA] and Protein Type in [Precursor]

Found 11 entries.


ID Name Gene superfamily Organism Sequence
P04013 Cal14.11 precursor Divergent M---L-LTVA Conus californicus
MRFLLLLTVALLLTCIMETDAE
AKPEDLAERFRER
SDCSGM
SDGTSCGDTGVCQNGLCMGAGS
P03980 Cal14.14 precursor Divergent M---L-LTVA Conus californicus
MKFLLFLSVALLLTSFIETEA
GPVNEAGVERLFRALVGR
GC
PADCPNTCDSSNKCSPGFP
G
P04022 Cal14.14 precursor Divergent M---L-LTVA Conus californicus
MKFLLFLSVALLLTSFIETEA
GPVNEARVERLFRALVGR
GC
PADCPNTCDSSNKCSPGFP
G
P04020 Cal14.4 precursor Divergent M---L-LTVA Conus californicus
MKFLLFLSVALLLTSFIET
VTVNKAGMERPSRALVGR
GCPA
ECPDTCSSSGSCAPDFI
G
P04028 Cal6.12 precursor Divergent M---L-LTVA Conus californicus
MKFYLLLTAALLLTAVIIEA
APTDHQDEARDLMREER
DDKS
NCPISHPNYCSFTPVCCKHECLSNNKCSSSEFIPGQ
P03989 Cal9.2a precursor Divergent M---L-LTVA Conus californicus
MNCYLILTVALLLTSAMT
GTTTAGQLNKKGVTLR
EDDGFPC
NAGNCACLPLDSYSYTCQSPTSSTANCEGNECVSEADW
P04046 Cal9.2c precursor Divergent M---L-LTVA Conus californicus
MNCYLILTVALLLTSAMT
GTTTAGQLNKKGVTLR
EDDRFPC
NAGNCACLPLDSYSYTCQSPTSSTANCEGNECRSEADW
P04048 Cal9.2f precursor Divergent M---L-LTVA Conus californicus
MNCYLILTVALLLTSAMT
GTTTAGQLNTKGVTLR
EDDRTFP
CSSGLCACLPLDSYSYICLSPSSSTANCENDECISEDDW
P04047 Cal9.4 precursor Divergent M---L-LTVA Conus californicus
MNCYLILTVALLLTSAMT
GTTTAGQLNKKGVTLREDDR
FPC
NPGGCACRPLDSYSYTCQSPSSSTANCEGNECVSEADW
P07842 Qc9.1 precursor Divergent M---L-LTVA Conus quercinus
LVTVTLLLTLVMSIDSVPA
DETETGRVSLREDDR
FPCNSNQ
CACLPAEGSSTSYQCQSLDASTDDCFDNECVTQSEW
P07843 Qc9.2 precursor Divergent M---L-LTVA Conus quercinus
LATVALLLTLVMGIDSAPA
GQTEAGRVSLR
EGLENTFPCNP
GRCACLPASGTTTSYVCQSTQSSTADCMDNECVTEAEW