Protein List

Your search: Gene superfamily in [Divergent MKLLLTLLLG] and Protein Type in [Precursor]

Found 2 entries.


ID Name Gene superfamily Organism Sequence
P04055 conotoxin CalMKLL-1 precursor Divergent MKLLLTLLLG Conus californicus
MKLLLTLLLGSALMCITLA
DECGLGTHRPVKEVIDNVRTMY
YCDCRAGDAERSITVSRCDDNNQKQDDVILTYCGLEQTTGC
NTNPYTAAKHDSSGDKPQFYCSCLNYKYEQSHSDYRHWTIR
CYMGNICD
P04056 conotoxin CalMKLL-2 precursor Divergent MKLLLTLLLG Conus californicus
MKLLLTLLLGSALMCITLA
DECGLGTHRPVKEVIDNVRTMY
YCDCRAGDAERSITVSRCDDNNQKQDDVILTYCGLEQTTGC
NTNPYTAAKHDSSGDKPQFYCSCLNYKYEQSHADSRYWTIR
CYMGDICD