Protein List

Your search: Gene superfamily in [Divergent MKVAVVLLVS] and Protein Type in [Precursor]

Found 1 entry.


ID Name Gene superfamily Organism Sequence
P04014 Cl14.12 precursor Divergent MKVAVVLLVS Conus californicus
MKVAVVLLVSLLAVTYA
LPEKRIFFGGIVDKVKDTFTKIFN
KAKETFDKITDGFDVDFDEVVDKLIAQIHSTPTK
AACKAAC
KKGAKLILKAAAPLASQVCGPACNAALA
KLEKIADDINDDD
D