Protein List

Your search: Gene superfamily in [Divergent MSTLGMTLL-] and Protein Type in [Precursor]

Found 6 entries.


ID Name Gene superfamily Organism Sequence
P04001 Cal22a precursor Divergent MSTLGMTLL- Conus californicus
MMSTKGITLFLCLLLLALATSVNG
GQGTRRSRMTRALHGGR
PSAR
YDAPYCSQEEVRECHDDCSGNPVRDACQCAYDPAGSP
ACDCYCVEPW
RR
P04002 Cal22f precursor Divergent MSTLGMTLL- Conus californicus
MMSTKGITLFLCLLLLALATSVNG
GQGTRRSRMTRALHGGR
PSAR
YDAPYCSEEELQACDCSHNPVRDACLCQYDPAGSPAC
ECFCVEPW
RR
P04006 Cl10.1 precursor Divergent MSTLGMTLL- Conus californicus
MTTLGMTMLVLLLLLPLATCLG
DGERSPWDSLLRALR
SDPQ
ACEPTISGGEMICRDEVCASTGCNCGYNIAKAHCYCACP
P04049 Cl9.6 precursor Divergent MSTLGMTLL- Conus californicus
MSTLGMTLLILLLLLPLAT
PDDVGQPPKRDTLRNLLKIGTR
GQGGCVPPGGGRCKANQACTKGGNPGTCGFQYDLCLCLRN
P02842 Di19A precursor Divergent MSTLGMTLL- Conus distans
MSTLGILLPIALLLPLANPAE
NGDGQAMPRTRNLRSLSFGR
TLRRLEKR
GCDPTDGCQTTVCETDTGPCCCKPNFTCQISNS
GTKSCSCSGQPSDCPV
P05672 Pu19.1 precursor Divergent MSTLGMTLL- Conus pulicarius
MSTLGMLLLVALLLPLDNP
ADNGDGQAKPRSRNLRSLDFGR
TPRRLDKR
TCDPTPDCRTTVCETDTGPCCCPHGYNCQTTNS
GRRACVLVCPHNCPP