Protein List

Your search: Gene superfamily in [E superfamily] and Protein Type in [Precursor]

Found 2 entries.


ID Name Gene superfamily Organism Sequence
P08484 E22.1 precursor E superfamily Conus ermineus (Atlantic fish-hunting cone)
MMTRVFIAMFFLLALTEG
WPRLTDSDCELGRNMHITCKQLD
QCGVIEKKDGQLTCKLRCKCKPGKRCLRKENIDWSDITTRI
YHCPWP
P05506 Mr22.1 precursor E superfamily Conus marmoreus
MMTRVFFAMFFLMALTEG
WPRLYDSDCVRGRNMHITCFKDQ
TCGLTVKRNGRLNCSLTCSCRRGESCLHGEYIDWDSRGLKV
HICPKPWF