Protein List

Your search: Gene superfamily in [F superfamily] and Protein Type in [Precursor]

Found 2 entries.


ID Name Gene superfamily Organism Sequence
P06386 F_Vc1 precursor F superfamily Conus victoriae
MQRGAVLLGVVAFLALWPQAGA
EPYNLNDPDVRAMINDGR
K
LMDTCAKANHYIADRWSTYRIEYLEDKGLYHRMLRELVPCL
NNFLRTRQEAP
P05508 Mr105 precursor F superfamily Conus marmoreus
MQRGAVLLGVVALLVLWPQAGA
ELYDVNDPDVR
AMVIDGQK
LMHDCAIANDYIDDPWWTLNLGAFEEKRVYHSMLSELVFCL
NAFLQ
RRQQAP