Protein List

Your search: Gene superfamily in [G2 superfamily] and Protein Type in [Precursor]

Found 17 entries.


ID Name Gene superfamily Organism Sequence
P08592 Di27.1 precursor G2 superfamily Conus distans
MNFYLLLTVTLLLASFTGGDA
RRIQGMDIYRHFVR
RDCGRD
CVGCDNPANCCCGGQTCVNGNKCE
P08594 Di27.2 precursor G2 superfamily Conus distans
MNFYLLLTVTLLLASFTGGDA
RRIQGMDIYRHFVR
RDCGKD
CVGCDNPANCCCGGQTCVNGNKCE
P08582 Eb27.1 precursor G2 superfamily Conus ebraeus
MEFRRLVTVALLLALVLSIDA
EPMQGMEAEGHFVR
RDCGEG
CGTCGGGCCCIPDSCVDSQCQSHVGPN
P08584 Eb27.2 precursor G2 superfamily Conus ebraeus
MEFRRLVTVALLLALVLSIDA
EPMQGMEAEGHFVR
RDCGEG
CGTCGGGCCCIPDSCVDSQCQSRVRPN
P08586 Eb27.3 precursor G2 superfamily Conus ebraeus
MEFRRLVTVALLLALVLSIDA
EPMQGMEAEGHFVR
RDCGEG
CGTCGGRCCCMPNSCVDSQCQGRVGPN
P08588 Eb27.4 precursor G2 superfamily Conus ebraeus
MEFRRLVTVALLLALVLSIDA
EPMQGMEAEGHFVR
RDCGEG
CGTCGGGCCCIPDSCVDSQCQSLRGA
P08598 Fla27.1 precursor G2 superfamily Conus flavidus
MRVYLLLTVTLLLTSFTGADA
GPMPANGHFVR
RDCQWGCEG
CRNRAGCCCGDQVCVDNNRCE
P08600 Fla27.2 precursor G2 superfamily Conus flavidus
MRVYLLLTVTLLLTSFTGADA
GPMPANGHFVR
RDCQWGCEG
CHNRAGCCCGDQVCVDNNRCEP
P06722 Mi27.2 precursor G2 superfamily Conus miles
MRFFFLLLTVALFLTSITGDDA
ERMLGMKEGGYVR
EDCGSD
CAPCGGECCCEPNSCIDGTCHHESSPN
P06721 MiXXVIIA precursor G2 superfamily Conus miles
MRFFFLLLTVALFLTSITGDDA
ERMLGMKEGGYVR
EDCGSD
CMPCGGECCCEPNSCIDGTCHHESSPN
P08581 Ml27.1 precursor G2 superfamily Conus miliaris
MEFRRLATVALLLALVLSIDA
EPMQGMEAEGHFVR
TDCDEG
CMKCGSGCCCSPNSCIDSQCRGQVPPQ
P08590 Ml27.2 precursor G2 superfamily Conus miliaris
MTFYLLLTVTLLLTVSTGGDA
GPRRANGLQKHFVR
RDCRTG
CVGCFNPNGCCCGGQVCVNGNHCEYKSSWF
P08596 Pl27.1 precursor G2 superfamily Conus planorbis
MRFYLLLTVTLLLTSFTGGDA
RLMQETKTDRLEN
RDCATGC
EGCNNPAKCCCGTQVCVNGNTCQ
P08604 Rt27.1 precursor G2 superfamily Conus rattus
MRFYLLLTVALFLTSITGGDA
RLMQGMEATRPFGR
RDCQRG
CHGCSNVPNGCCCGNLVCQNEQRCVPKE
G
P08602 Sa27.1 precursor G2 superfamily Conus sanguinolentus
MRCYLLSTVTLLLIWFSGGDA
GPRHAIGDFVR
RDCQTGCVG
CHNPAGCCCGGQVCVDNKRCEGGFY
P08577 Vr27.1 precursor G2 superfamily Conus varius
MRFYLLLTVTLLLTSFTGGDA
GSVQGKKAQGRFVR
RDCNTG
CVPCGDRCCCVPHSCIDSKCLGHATPHRAY
P08575 Vx27.1 precursor G2 superfamily Conus vexillum
MRFYLLLTVALFLTSITGGDA
GRMLRMRGGGHVVR
RSCASN
CVSCGSGCCCSPNSCVDSTCTHHSTPH