Protein List

Your search: Gene superfamily in [H superfamily] and Protein Type in [Precursor]

Found 10 entries.


ID Name Gene superfamily Organism Sequence
P06385 H_Vc1 precursor H superfamily Conus victoriae
MRTSGRLLLLCLAVGLLLESQA
HPNADAGDATR
DVGSDRTS
VELSKMLKGWQAEKGQ
R
KASAPKKFYVYPPV
RRSFY
P05498 Mr102 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLALGLVFESLG
IPVADDVEADRDTDPDDGD
PRGRNSWR
STDCNGVPCQFGCCVTINGMMNAGNLIVSDLTR
RGLLDNEGHCPAATES
P05500 Mr103 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLALGLVFESLG
IPVVDDVEADRDTDPDDGD
PRVVTPGGPRIATGYHVSSAAALQSTGMMNAGKLAVSDLTH
R
GCGMMRVTVQQPLSPEALSWTPNCNVS
P05494 Mr6.23 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLALGLVFESLG
IPVADDVEADRDTDPDDGD
PRGRNSWR
STDCNGVPCQFGCCVTINGNDECRELDC
P05513 Mr6.24 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLALGLVFESLG
IPVVDDVEADRDTDPDDGD
PRGRNSWR
STDCNGVPCEFGCCVTINGNDECREIGCE
P05496 Mr6.25 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLALGLVFESLG
IPVADDVEADRDTDPDDGD
PRGRNSWR
STDCNGVPCQFGCCVTINGNDECRDLIVSDLTR
RGLLDNEGHCPAATES
P05502 Mr6.26 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLTLGLVFELLG
IPVADDVEADRDADPDNGD
PRGRISWR
IEEDCGYVPCEFGCCRIIDGKEKCREIDCQ
P05504 Mr6.27 precursor H superfamily Conus marmoreus
MNTAGRLLLLCLALGLVFESLG
IPVADDVEADRDTDRDDGN
PRR
DDFMRIMCGDEFCTYDCCEIVDGSSKCKQPDCP
P06384 Vc7.1 precursor H superfamily Conus victoriae
MNTAGRLLLLCLALGLVFESLG
IPVADDVEAVRDTDPDEKD
PSVHNSLK
AVYGDCGGERCRFGCCKTDDGEEKCQHFGCP
P06383 Vc7.2 precursor H superfamily Conus victoriae
MNTAGRLLLLCLVLGLVFESLG
IPVADDLEADRDTDPDEKD
PSVHNYWR
NVNCGGVPCKFGCCREDRCREIDCD