Protein List

Your search: Gene superfamily in [I1 superfamily] and Protein Type in [Precursor]

Found 26 entries.


ID Name Gene superfamily Organism Sequence
P02801 ArXIA precursor I1 superfamily Conus arenatus
MKLCATFLLVLVTLPLVTG
EKSSERSLSGAILRGVR
RTCSR
RGHRCIRDSQCCGGMCCQGNRCFVAIRRCFHLPF
P01454 Bt11.1 precursor I1 superfamily Conus betulinus
MKLCVAFLLVLVILPSVIGG
KPSERTLSGATRRGDRR
MCLS
LGQRCERHSNCCGYLCCFYDKCVVTAIGCGHY
P04007 Cl11.1 precursor I1 superfamily Conus californicus
MKLALTFLLILMILPLTTG
GKKSDNQALKRLGAR
KFNENLS
ELNSACDDAWETCAWSRTCCSRNCCRGICVSRYYECP
P04008 Cl11.2 precursor I1 superfamily Conus californicus
MKMSVTFLLILMILPLF
TGEWQSGSRLSALKKRLLEKRLLQ
KR
FCTEIGKDCGTSWECCEDCCIHGTCSHESNCANFKL
R
P04031 Cl6.15 precursor I1 superfamily Conus californicus
MKLSVKFLLFLMILPLIAG
EDMSDNDAPKSVDVQRNVKR
QG
QSQFGEQCTGHLDCFGDLCCFDGYCIMTSWIWPCNW
P01453 Ep11.1 precursor I1 superfamily Conus episcopatus
MKLCVTFLLILVILPSVTG
EKSSKRTLSGAALR
GDWGMCSG
IGQGCGQDSNCCGDMCCYGQICAMTFAACGP
P04520 Im11.13 precursor I1 superfamily Conus imperialis
MKLALTFLLILMILPLMTG
EKTSGDHELRGVDSLKAILRDR
RCSDDTGATCSDNSDCCGDMCCLSNTCVVTIVACS
P04526 Im11.14 precursor I1 superfamily Conus imperialis
MVIMKLALTFLLILLILPLMNG
EKTSGDHELRGVDSLKAIL
RDR
RCSDDTGATCSNRFDCCESMCCIGGHCVISTVGCP
P02805 L11.5 precursor I1 superfamily Conus lynceus NWS
WCSGSGEGCDYHSECCGERCCIESMCIGDGVACWP
P05366 Mr11.1 precursor I1 superfamily Conus marmoreus
MKLSVTFLLILVILPSVTG
EKSSERTLSGAALR
DKWGTCSL
LGKGCRHHSDCCWDLCCTGKTCVMTVLPCLFLSLIVRWT
P05368 Mr11.2 precursor I1 superfamily Conus marmoreus
MKLSVTFLLILVILPSVTG
EKSSERTLSGAALR
DKWGTCSL
LGKGCRHHSDCCWDLCCTGKTCVMTVLPCHFFPL
P05370 Mr11.3 precursor I1 superfamily Conus marmoreus
CVLCVTFLLILVILPSLTG
EKSSERTLSGAALRHK
WGACSL
LGKDCGHSPDCCGDLCCIGGKCVMTDIPCHYFPF
P05644 Pu11.3 precursor I1 superfamily Conus pulicarius
MKLCVTFLLVLVTLPLVTG
EKSSEHSLSGATLRRDRR
TCSS
RGHRCTRDFHCCGGMCCYGYRCVVAFRPCYNHSV
P05648 Pu11.5 precursor I1 superfamily Conus pulicarius
MKLCVTFLLVLVTLPLVTG
EKSSERSLSGVILRGVRR
TCSL
PGDGCIRDFHCCGHMCCQGNKCVVTVRRCFNFPY
P01410 R11.3 precursor I1 superfamily Conus radiatus
MKLCLTFLLVLMILASVTG
EKLSEQTLRRAARKNK
GPRCWV
GRVHCTYHKDCCPSVCCFKGRCKPQSWGCWSGPT
P04225 RXIA precursor I1 superfamily Conus radiatus
MKLCLTFLLVLMILASVTG
EKSSKHTLSRAARVKNR
GPSFC
KADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI
P01409 RXIC precursor I1 superfamily Conus radiatus
MKLCLTFLLVLMILASVTG
EKSSKHTLSRAARVKNR
GPSFC
KADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT
R
P06068 S11.1 precursor I1 superfamily Conus striatus (Striated cone)
MKLCVTFLLVLVILPSVTG
EESSER
TLSGATLTGGRGMCSL
LGQRCGDHSDCCWDMCCASEMCVVTFLPC
K
P06067 Tx11.3 precursor I1 superfamily Conus textile (Cloth-of-gold cone)
MKLCVTFLLVLVILPSVTG
VKSSERTLSGAALRGDR
GTCSG
RGQECKHDSDCCGHLCCAGITCQFTYIPC
K
P06066 Tx11.4 precursor I1 superfamily Conus textile (Cloth-of-gold cone)
MKLCVTFLVVLVILPSVTG
EKSSERTLSGAALRGDRR
TCSN
KGQLCGDDSDCCWHLCCVDNKCAHLILLCNL
P06382 Vc11.1 precursor I1 superfamily Conus victoriae
MKLCVTFLLVLVILPSVTG
EESSERTLSGATLTGDRR
TCSD
LGQACVHESDCCAQMCCLNKKCAMTMPPCNFY
P06381 Vc11.2 precursor I1 superfamily Conus victoriae
MKLCVTFLLVLVILPSVTG
EKSSERTLSGAALRGDRR
TCSD
LGQACVHESECCAQMCCLHKKCAMTHCNFY
P06380 Vc11.3 precursor I1 superfamily Conus victoriae
MKLCVTFLLVLVILPSVTG
EKSSEHTLSGAALRGDR
GTCSG
RGQECKHDSDCCGHLCCAGIKCHFTYFPC
K
P06379 Vc11.4 precursor I1 superfamily Conus victoriae
MKLCVTFLLVLVILPSVTG
EKSSERTLSGAALRVDR
GTCSY
LGEGCKRDSDCCGHFCCGGKTCVITARPCKV
P06378 Vc11.5 precursor I1 superfamily Conus victoriae
MKLRVTFLLVLVILPSVTG
EKSSERTLSGAALRSDRR
TCSN
KGEQCEDDSDCCWHLCCVDNKCAKLILLCNL
P06377 Vc11.6 precursor I1 superfamily Conus victoriae
MKLCVTFLLVLVILPSVTG
EKSSER
TRSFADLPDDWGMCSD
IGEGCGQDYDCCGDMCCDGQICAMTFMACMF