Protein List

Your search: Gene superfamily in [I2 superfamily] and Protein Type in [Precursor]

Found 63 entries.


ID Name Gene superfamily Organism Sequence
P01106 BtX precursor I2 superfamily Conus betulinus
MMFRVTSVGCLLLVIVFLNLVVPTSA
CRAEGTYCENDSQCC
LNECCWGGCGHPCRHP
GKRSKLQEFFRQR
P01392 Cp1.1 precursor I2 superfamily Conus capitaneus
MMFRLTSVSCFLLVIACLNLFQVVLT
RR
CFPPGVYCTRHLP
CCRGRCCSGWCRPRCFPRY
GKRATFQ
P01457 Em11.10 precursor I2 superfamily Conus emaciatus
CFPPGIYCTPYLPCCWGICCGTCRNVCHLRI
GKRATFQE
P03809 Em11.3 precursor I2 superfamily Conus emaciatus
MMFRLTSVGCFLLVIACLNLFQVVLT
RRCFPPGTFCSRYLP
CCSGRCCSGWCTRRCFPRF
GKRATFQE
P03810 Em11.5 precursor I2 superfamily Conus emaciatus
MMFRLTSVGCFLLVIACLNLFQVVLT
RRCFPLGTFCSRYLP
CCSGMCCSGWCTRRCAPRF
GKRATFQE
P03811 Em11.8 precursor I2 superfamily Conus emaciatus
MMFRLTSVSCFLLVIACLNLFQVVLT
SRCFPPGIYCTPYLP
CCWGICCGTCRNVCHLRF
GKRATFQE
P03863 Em12.1 precursor I2 superfamily Conus emaciatus
MFGHTSVSFLLLSIMALGMVPTVIC
WCSERVSDETCVMMCR
CLNHECCPLPPPSQNRCMPSDHCDFMSGRT
GRRRSTQMLRA
IAN
P01455 Ep11.12 precursor I2 superfamily Conus episcopatus
MMFRVTSVGCFLLVILSLNLVVLTNA
CLSEGSPCSMSGSCC
HKSCCRSTCTFPCLIP
GKRAKLREFFRQR
P03812 Eu11.3 precursor I2 superfamily Conus eburneus
MMFRLTSVWCLLVIVLLNSAVDG
FIPCTGSEGYCHSHMWCC
NSFDVCCELPGPATCTREEACETLRIA
LGRRAQYKRFFRR
P03813 Eu11.7 precursor I2 superfamily Conus eburneus
MMFRLTSVSCFLLVIVCLNLFQVVLT
RRCFPPGTFCSRYLP
CCSGRCCSGWCTRRCFPRF
GKRATFQE
P03861 Eu12.4 precursor I2 superfamily Conus eburneus
MFGHTSVSFLLLSIMALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSSKRDQCMTWNRCLSAQTGN
RRSTHMQ
KRFLRMPRDLAD
P03860 Eu12.7 precursor I2 superfamily Conus eburneus
MFGHTSVSFLLLSIMALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACHIF
RKPVGSR
P05226 Fe11.1 precursor I2 superfamily Conus ferrugineus
MMFRVTSVGCFLLVIVLLHVAAVTS
DDCRPEAAYCEYNEQC
CIDKCCQASCSDACRTP
GKRVHGHGLLRFFGQR
P01456 Fi11.11 precursor I2 superfamily Conus figulinus
CHHEGLPCTSGDGCCGMECCGGVCSSHCGN
GRRRQVPLKSF
GQR
P05396 Gla-MrII precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSSKRDQCMTWNRCLSAQTGN
RRSTHMQ
KRFLRMPRDLAD
P03859 Gla-MrII precursor I2 superfamily Conus marmoreus
MFGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSSKRDQCMTWNRCLSAQTGN
RRSTHMQ
KRFLRMPRDLAD
P01395 Im11.1 precursor I2 superfamily Conus imperialis
MMFRLTSVSCFLLVIACLNLVVLTNA
CLRDGQSCGYDSDCC
RYSCCWGYCDLTCLIN
GKRATFQ
P03814 Im11.10 precursor I2 superfamily Conus imperialis
MMFRLTSVSCFLLVIVCLNLFQVVLT
RRCFPPGTFCSRYLP
CCSGRCCSGWCTRRCFPRF
GKRATFQE
P01394 Im11.2 precursor I2 superfamily Conus imperialis
MMFRLTSVSCFLLVIVCLNLVVLTNA
CRLEGSSCRRSYQCC
HKSCCIRECKFPCRWD
GKRATFQ
P03815 Im11.3 precursor I2 superfamily Conus imperialis
MMFRLTSVSCFLLVIACLNLFQVVLT
SRCFPPGIYCTPYLP
CCWGICCGTCRNDNSSLTFLQFCLPFFFF
LRPSHPLFLLLP
AR
P01393 Im11.4 precursor I2 superfamily Conus imperialis
MMFRLTSVSCILLVIAFLNLVGLTNA
CTSEGYSCSSDSNCC
KNVCCWNVCESHCGHH
GKRATFQ
P04522 Im11.7 precursor I2 superfamily Conus imperialis
MFRVTSVGFILLVIVLLNLVVLTDA
YYHQCTLTEEGNPCTY
DWQCCHMICCYNSCTFGCKRRRRFRLLD
KR
P03871 Im12.10 precursor I2 superfamily Conus imperialis
MFGHTSVSFLLLSIMALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACHIF
RKPVGSR
P03816 Lt11.1 precursor I2 superfamily Conus litteratus
MMFRLTSVLLVIVLLNLVVLTNA
CHMDCSKMICCSGICCFY
CGLPSCDDT
RRALLQRLLGHQR
P03817 Lt11.2 precursor I2 superfamily Conus litteratus
MMFRLTSVSCFLLFIVFLNLVVLTNA
CIPEGTYCQFNADCC
LSQCCWGSCGNPCRFP
GKREKLQEFFRQR
P03818 Lt11.3 precursor I2 superfamily Conus litteratus
MMFRLTSVGCILLVIAFLNLVGLTNA
CTSEGYSCSSDSNCC
KNVCCWNVCESHCRHPGKR
TRLQGFFKHRR
P03819 Lt11.6 precursor I2 superfamily Conus litteratus
MMFRLTSVGSFLLVIVFLNLVVLTNA
CDLEGMFCMYDFECC
LSECCMGICAFGCT
KRAQRQKLLRSFGQR
P03853 Lt12.4 precursor I2 superfamily Conus litteratus
MFGHTSVSFLLLSIMALGMVPTVIC
WCSERVSDETCVMMCR
CLNHECCPLPPPSQNRCMPSDHCDFMSGRT
GRRRSTQMLRT
IAN
P03862 Lt12.9 precursor I2 superfamily Conus litteratus
MFGHTSVSFLLLSIMVLGVVATVIC
SCGVRISSEICEQPEE
RICSCSNHMCCPLNPSQRDQCMARNVCFIMIGIYG
GRRSTR
MQERFLRMSRGLADYSV
P06719 Mi043 precursor I2 superfamily Conus miles
MMCRLTSLCCLLVIVLLNSAVDG
VPCQQGGGKCSSDLKCCD
GRDVCCGTSGSATCTIESECSGERITHTHRALHARFF
RR
P01084 Mi11.1 precursor I2 superfamily Conus miles
MMLRLTSVSCFLLVIACLNLFQVVLT
RR
CFPPGTFCSRYLP
CCSGRCCSGWCTRRCSPRY
GKRATFQE
P05408 Mr026 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCLLPQSYVLSVESIQTGSVYVLGSVPHISKTS
G
P05397 Mr12.10 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSRQKGSQCTTWNRCLSAQTGN
RRSTHI
DKKIPYVCHVILPTSLCDKRAD
P05399 Mr12.11 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACLIF
RKPVGSRSTHMQ
KKFLRMPRDLADQCV
P05406 Mr12.12 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACHIF
RKPVGSRSTHMQ
KIPSYAT
P05401 Mr12.12 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACHIFRKPVGSRSTHMQ
KKIPSYARDLADQCV
P05403 Mr12.12 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACRIFRKPVGSRSTHMQ
KKIPSYAT
P05404 Mr12.13 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCFCPNHMCCPLSPYRQDQCMYWEACHTFRKPVGSRSTHTQ
KKIPSYAT
P03858 Mr12.8 precursor I2 superfamily Conus marmoreus
MFGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSSKGDQCMTWNRCLSAQTGN
RRSTHMQ
KRFLRMPRDLAD
P05394 Mr12.9 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
SCDSEFSSEFCEQPEE
RICSCSTHVCCHLSSRKRDQCMTWNRCLSAQTGN
RRSTHMT
KRFLRMPRDLAD
P05410 Mr14.6 precursor I2 superfamily Conus marmoreus
MSGHTSVNFLLLSIVALGMVATVIC
LCDSYISSELCEHPEE
TCLLPQSYVLSVESIQTGSVYVLEACRIFTKTS
G
P05658 Pu11.10 precursor I2 superfamily Conus pulicarius
MMCRMTSLCCLLVIVLLNSAVDA
CNGRGEWCSTHRSCCDSG
DVCCITPVGPICTRGCSGRIIPQRRGAQLRHFF
RR
P05656 Pu11.9 precursor I2 superfamily Conus pulicarius
MMCRMTSLCCLLVIVLLDSAVDA
CNGRGEWCSTHRSCCDSG
DVCCITTPVGPICTRGCSGRIIPQRRGAQLRHFF
RR
P01391 S11.3 precursor I2 superfamily Conus striatus (Striated cone)
MMFRLTSVSCFLLVIVCLNLFQVVLT
RR
CVPPSRYCTRHRP
CCRGTCCSGLCRPMCNLWY
GKRATFQE
P03896 Sr11B precursor I2 superfamily Conus spurius
MMFRVTSVGCFLLVIVFLNLFVLTNA
CDSDGTSCTSNMECC
GYGCCSGTCQTPCRFGP
GKRERLQEFFQHR
P03898 Sr11C precursor I2 superfamily Conus spurius
MMFRVTSVGCFLLVIVFLNLSPG
FTYTRTALQRTLSQTGKR
DYPEHVWEWHLSR
CSDEGASCEKKSDCCFLSCCWSVCDRPC
RLVP
GKRAQLQKFLRHR
P03895 SrXIA precursor I2 superfamily Conus spurius
MMFCVTSVRCFLLVIVFLNLVVLTNA
CRTEGMSCEENQQCC
WRSCCRGECEAPCRFGP
GKRAQLQEFFQHR
P01452 Sx11.2 precursor I2 superfamily Conus striolatus
MMFRVTSVGCLLLVIVFLNLVVPTSA
CRAEGTYCENDSQCC
LNECCWGGCGHPCRHP
GKRSKLQEFFRQR
P01056 TxX precursor I2 superfamily Conus textile (Cloth-of-gold cone)
MSGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCERPEE
SCSCSTHTCCHWARRDQCMKPQRCISAQKGN
GRRRLIHMQK
P01057 TxXI precursor I2 superfamily Conus textile (Cloth-of-gold cone)
MVRVTSVGCFLLVIVSLNLVVLTNA
CIPEGSSCSSSGSCCH
KSCCRWTCNQPCLIP
GKRAKLLEFFRQR
P06373 Vc11.10 precursor I2 superfamily Conus victoriae
MVRVTSVGCFLLVIVFLNVVVLTNA
CAPPGSSCNHTDNKCC
ISACCFGACVLPCQVP
GKRAKLLEFFRQR
P06376 Vc11.7 precursor I2 superfamily Conus victoriae
MVRVTSVGCFLLVIVFLNLVVPTNA
CAGNEEACTVASDCCG
SFNCCNGYCDAPCRQP
GKRVKLREFFRQR
P06375 Vc11.8 precursor I2 superfamily Conus victoriae
MVRVTSVSCFLLVIVFLNLVVLTNA
CISEESPCSSSGSCCQ
RSCCYGNCRFPCLQP
GKRAKLREFFRQR
P06374 Vc11.9 precursor I2 superfamily Conus victoriae
MVRVTSVGCFLLVIVFLNLIVPTTTS
DCIPEGSHCGISSDC
CKSTCCMETCEDPCRYTW
KRAKLQELFRQR
P06372 Vc12.1 precursor I2 superfamily Conus victoriae
MSGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCERPEE
SCSCLTHSCCHWSRRDQCMTPQRCISAQKGN
GRRRLTHMQK
P04510 Vi11.2 precursor I2 superfamily Conus virgo
MMFRLTSVSCFLLVIACLNLVVLTNA
CLRDGQSCGYDSDCC
RYSCCWGYCDLTCLII
GKRATFQELILHR
P04513 Vi11.3 precursor I2 superfamily Conus virgo
MMFRLTSVGCFLLVIACLNLFQVVLT
RR
CFPPGVYCTRHLP
CCRGRCCSGWCRPRCFPRF
GKRATFQE
P04512 Vi11.5 precursor I2 superfamily Conus virgo
MMFRFTSVSCFLLVIVCLNLVVLTNA
CRLEGSSCRRSYQCC
HKSCCIRECKFPCRWV
GKRATFRELILHH
P00845 ViTx precursor I2 superfamily Conus virgo
MMFRLTSVSCFLLVIACLNLFQVVLT
SRCFPPGIYCTPYLP
CCWGICCGTCRNVCHLRI
GKRATFQE
P03807 Vt11.3 precursor I2 superfamily Conus vitulinus
MMFRLTSVGCFLLAIVLLNVAVLTNA
SCRNEGAMCSFGFQC
CKKKCCMSHCTDFCRNP
GKRAHGHGLLRFWGQR
P03808 Vt11.7 precursor I2 superfamily Conus vitulinus
MMFRLTSVGCFLLVIVLLNVAVLTNA
SCRNEGAMCSFGFQC
CKKECCMSHCTDFCRNPD
KRAHGHGLLRFWGQR
P01085 Vx11.1 precursor I2 superfamily Conus vexillum
MMFRLTSVSCFLLVIACLNLFQVVLT
SRCFPPGIYCTPYLP
CCWGICCDTCRNVCHLRI
GKRATFQE
P01086 Vx11.2 precursor I2 superfamily Conus vexillum
MMFRLTSVSCFLLVIACLNLFQVVLT
SRCFPPGIYCTPYLP
CCWGICCDTCRNVCHLRF
GKRATFQE