Protein List

Your search: Gene superfamily in [I3 superfamily] and Protein Type in [Precursor]

Found 13 entries.


ID Name Gene superfamily Organism Sequence
P03797 Ca11.3 precursor I3 superfamily Conus caracteristicus
MKLVLAIVVILMLLSLSTGA
EMSDNHASRSATALRDRLLSP
K
ASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPCK
P03793 Ca11A precursor I3 superfamily Conus caracteristicus
MKLVLAIVVILMLLSLSTGA
EMSDNHASRSATARRDRHLSP
K
AWPCGGVRASCSRHDDCCGSLCCFGTSTGCRVAVRPCW
P03795 Ca11B precursor I3 superfamily Conus caracteristicus
MKLVLAIVVILMLLSLSTGA
EMSDNHASMSANALRDRLLGP
K
ALLCGGTHARCNRDNDCCGSLCCFGTCISAFVPC
P07689 Ca6.4 precursor I3 superfamily Conus caracteristicus
VILMLLSLSTGA
EKSGLEISMVGPPLYFWSPSPAC
KLSGED
CGYGYSCCEDLSCRPLIEPDTLKITALVCQIESA
P08114 Ca6.5 precursor I3 superfamily Conus caracteristicus
HASRSATAWRDRHLSPK
ALLCGGVRASCSRHDDCCGSLCCF
GTSTGCRVAVRPCW
P05919 Di11.1 precursor I3 superfamily Conus distans
MKLVLAIILILMLISLSTG
AETSDSRASMSATAETDGLLRV
K
SSMCKQSNGPCSGNFDCCGNLCCTWDNTCGDKIGGC
P07650 G11.1 precursor I3 superfamily Conus geographus (Geography cone)
MKLFLAIVLILMLQFLSTGAET
SDNHASRSTTALRDWLLGP
KAKRC
AVTHEKCSDDYDCCGSLCCVGICAKTIAPC
K
P05781 G11.1 precursor I3 superfamily Conus geographus (Geography cone)
MKLFLAIVLILMLLSLSTG
AETSDNHASRSATALRDWLLGP
LAKR
CAVTHEKCSDDYDCCGSLCCVGICAKTIAPCK
P07770 Ge11.4 precursor I3 superfamily Conus generalis
MKLFLVIVLNLMLLSLSTG
AETSDNRASRSATALRDRLRRP
KR
CRNRFEECWEDSECCEELCCDGPNYCKDSIGRCH
P03805 Lt6.1 precursor I3 superfamily Conus litteratus
MKLVLAIVLILMFLSLSAGA
ETSDNGVSRGGHRPQYWPVTP
PSIV
CLRSGEDCENNTPCCPGLSCRVSADLATLKLSLACD
P03799 Pu11.1 precursor I3 superfamily Conus pulicarius
MKLVLAIVLILMLLSLSTGA
EMSDNHASRSATALTDRLLGP
K
ASICRGTGGRCTKDKHCCGWLCCGGPSVGCATSFAPCN
P03801 Pu11.2 precursor I3 superfamily Conus pulicarius
MKLVLAIVLILMLLSLSTGA
ETSDNSASSSATALRDRLLGR
K
VRTCQGMGESCSSNYDCCGSLCCAGASLFNGCVMGFVAC
P03803 Pu6.1 precursor I3 superfamily Conus pulicarius
MKLVLAIVLILMLVSLSTGA
EESGQEISMVGPPLYIWDPIP
P
CKQLDEDCGYGYSCCEDLSCQPLIEPDTMEITALVCQIES
A