Protein List

Your search: Gene superfamily in [I3 superfamily] and Protein Type in [Precursor]

Found 9 entries.


ID Name Gene superfamily Organism Sequence
P03797 Ca11.3 precursor I3 superfamily Conus caracteristicus
MKLVLAIVVILMLLSLSTGA
EMSDNHASRSATALRDRLLSP
K
ASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPCK
P03793 Ca11A precursor I3 superfamily Conus caracteristicus
MKLVLAIVVILMLLSLSTGA
EMSDNHASRSATARRDRHLSP
K
AWPCGGVRASCSRHDDCCGSLCCFGTSTGCRVAVRPCW
P03795 Ca11B precursor I3 superfamily Conus caracteristicus
MKLVLAIVVILMLLSLSTGA
EMSDNHASMSANALRDRLLGP
K
ALLCGGTHARCNRDNDCCGSLCCFGTCISAFVPC
P05919 Di11.1 precursor I3 superfamily Conus distans
MKLVLAIILILMLISLSTG
AETSDSRASMSATAETDGLLRV
K
SSMCKQSNGPCSGNFDCCGNLCCTWDNTCGDKIGGC
P05781 G11.1 precursor I3 superfamily Conus geographus (Geography cone)
MKLFLAIVLILMLLSLSTG
AETSDNHASRSATALRDWLLGP
LAKR
CAVTHEKCSDDYDCCGSLCCVGICAKTIAPC
K
P03805 Lt6.1 precursor I3 superfamily Conus litteratus
MKLVLAIVLILMFLSLSAGA
ETSDNGVSRGGHRPQYWPVTP
PSIV
CLRSGEDCENNTPCCPGLSCRVSADLATLKLSLACD
P03799 Pu11.1 precursor I3 superfamily Conus pulicarius
MKLVLAIVLILMLLSLSTGA
EMSDNHASRSATALTDRLLGP
K
ASICRGTGGRCTKDKHCCGWLCCGGPSVGCATSFAPCN
P03801 Pu11.2 precursor I3 superfamily Conus pulicarius
MKLVLAIVLILMLLSLSTGA
ETSDNSASSSATALRDRLLGR
K
VRTCQGMGESCSSNYDCCGSLCCAGASLFNGCVMGFVAC
P03803 Pu6.1 precursor I3 superfamily Conus pulicarius
MKLVLAIVLILMLVSLSTGA
EESGQEISMVGPPLYIWDPIP
P
CKQLDEDCGYGYSCCEDLSCQPLIEPDTMEITALVCQIES
A